SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000016825 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000016825
Domain Number 1 Region: 31-417
Classification Level Classification E-value
Superfamily Sema domain 7.98e-94
Family Sema domain 0.0000848
Further Details:      
 
Domain Number 2 Region: 1297-1425,1632-1818
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.12e-36
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 808-900
Classification Level Classification E-value
Superfamily E set domains 2.6e-16
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 466-517
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000249
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 899-990
Classification Level Classification E-value
Superfamily E set domains 0.0000000000043
Family Other IPT/TIG domains 0.03
Further Details:      
 
Domain Number 6 Region: 988-1085
Classification Level Classification E-value
Superfamily E set domains 0.0000000084
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.049
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000016825
Domain Number - Region: 1099-1160
Classification Level Classification E-value
Superfamily E set domains 0.00296
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number - Region: 469-498,610-647,745-812
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0116
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 1427-1481
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0148
Family Ubiquitin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000016825   Gene: ENSXETG00000007706   Transcript: ENSXETT00000016825
Sequence length 1848
Comment pep:known scaffold:JGI_4.2:GL172790.1:1368746:1394529:1 gene:ENSXETG00000007706 transcript:ENSXETT00000016825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYFPPWQLTVMLGLAPFLLSFLCNCLPVSSVPSFLRPNVTFNHMARDPTSGFIYIGAVNW
IFQLSSDLQLLLEDSTGPREDSPECLPFKDLKDCRQATLTPNTNKLLAVNTHGGELITCG
QVFQGICEKRRLSNISDIIFQTIDPGDNQFVAANDPKVTTVGIVEGPSENHQLLFVGRGL
TARLSSGIPPITIRQLEKTPVFSNEGLGKLVVGDFSDYNNTFVGIFSNNGHVYFLFFRRG
SKSQMDYNTYLGSVCTGDVHLYSYVEVPLVCQGGYNLAQAAYLETGNRELFVVFAASQGP
TPNPSSRTALCSYKMVDIESRIENAREMCYTNAGMLFLCWCLQPIPASDQDTPQLFQCGG
EHTPSPIASRVPVEATPLLKDLSSLTAVAALAEDTYTIAFLGDAAGNIHKLEVPSPSQSN
SPWPGLKVHVSQPSLLRVVCIALNHKSQLEVFREFCQVTKMPVAECSTFSSCDSCLAARD
PFCGWCVLQGRCMAKQQCVDYTEENHYLWSYDKEATCLAIEDITPANQSRTQQRLVTLTV
PGLPSVEEQSSWKCLFDDISNEAIVHGSHVTCWTPLPNVLPPNQPGKDHVVMRLALLFEN
ITIAEMNFSFYDCEAVMKCAGCVNSQWECHWCVNDYRCIHDTQNCSQDQLGGPDACPRIE
SVDGSTLIPVGVERELDLIGRNLQLLKEEVLGYSCVIDAHGTTTTLPAQIENVTGEKDVF
QVHCQTHKFEYSLRTLEHQVTIYVMTGDGHRVDDKEDIQVVLYNCSVGQSDCSRCQALHN
QYNCVWCTKMEGEACLHESECQHSAMDTCPTPTIYSFSPMTGIIQGGTTITITGANMGQK
AEDVSVKVASHPCTLLPDLYIISNRIVCTLSASNAEESGPVEVYVDALQPGVSVEHFTYQ
DPVLQSLHPLQGPIAGGTLITITGSKLLTGDLINITVGDIPCKIPNGGVAEGEIHCVTGA
SSVLEELPVSVFYGSAKRILEDTKYSYTENPTISLVYPSRCFYGGGRVIWVEGTNLDVVK
TPVMTVLAKLSSKEFSGPCSLNSSSLLKCFSPSISETFELVDVLFILDNLRIPFSSTREN
FTYIKNPTFKPLNRESPSKPYNLKPGNVLDIEGEGLDYGISKQEVGATIGNGICIVKTLT
HNHLYCEPPPESPQPLDQVHMGNLQFNLGQVKYDVDGQTAFPKEAKIGLAVVATLLVPIV
LIIIYMYRRQSKMAMRDYKKVLVQLENLETRVGDQCRKEFTDLMTEMMDLSSELEGSGIP
FLDYKTYVERIFFPVNIDSPIPKSLDVPAGRRSTVEQGLTQLSNLLNNKLFLTKLIETLD
AQLTLSQRDRCHAASLLTVALHGKLEYLTDVMKTLLANLIDQCVAKNPKLLFRSRTETIV
EKLLTNWMSICLQTDLREAAAEPLYMLYCAIKYQVDKGPVDAVTGKAKRTLNDCHLLRED
IDYHPMTLTVIVKSGRETHHVPVRVLDTDTITQVKQKILNQVYKGTPFSQRPAATTLDLE
WRSGNAGHLTLSDEDLTSLIQDQWKRLNTLHHYKVPDNATVALIPRLHNNQCETPSNSFI
GGEIAEGQNIILPAILSDTILSVYLTETPMLEDGDEGGIRTWHLVKPVEEPEVFKNRKSS
LRERERAKAIPEIFLTRLLSMKGTLQKFVDDAFQVMLGVNRQVPIAIKYFFDFLDEMAEK
HEITDAETVHIWKTNSLMLRFWVLILKNPQMVFDVEVSENVDSILAVIAQTFIDSCTISE
HKVGRDSPVNKLLYAREIPRYKQLVENYYADIKKTAAASYQEMNSFLTEQSGVHSTELNS
LVALQELYNYINKYYDQISSALEEDPNGQKMQLAYRLQQISALVENKV
Download sequence
Identical sequences F7DG79
ENSXETP00000016825 ENSXETP00000016825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]