SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000016875 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000016875
Domain Number 1 Region: 20-242
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.35e-87
Family Eukaryotic proteases 0.000000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000016875   Gene: ENSXETG00000025357   Transcript: ENSXETT00000016875
Sequence length 243
Comment pep:known scaffold:JGI_4.2:GL174116.1:54699:58384:1 gene:ENSXETG00000025357 transcript:ENSXETT00000016875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLLLFSLLGLAVAQPIEDDDKIVGGYHCSVPYQVSLNAGYHFCGGSLINEHWVVSAAH
CYQSKMELRIGENNIELLEGTEQFIQSAKIIRHPQYNSWTIDNDIMLIQLQEPAQLNNEV
QPIPLPTECPPVGSICLISGWGNTLSNGVNYPDLLQCIEAPILSDQECRQSYPGSITDNM
ICVGYLEGGIDSCQGDSGGPVVCDGELQGVVSWGRGCALPGYPGVYTKVCNYLSWIRDTI
ANN
Download sequence
Identical sequences Q5M902
NP_001011209.1.99540 gi|56611173|gb|AAH87759| gi|58332122|ref|NP_001011209| ENSXETP00000016875 ENSXETP00000016875 8364.ENSXETP00000016875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]