SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000017367 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000017367
Domain Number 1 Region: 191-417
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-55
Family Voltage-gated potassium channels 0.00073
Further Details:      
 
Domain Number 2 Region: 40-148
Classification Level Classification E-value
Superfamily POZ domain 2.88e-30
Family Tetramerization domain of potassium channels 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000017367   Gene: ENSXETG00000007921   Transcript: ENSXETT00000017367
Sequence length 484
Comment pep:known scaffold:JGI_4.2:GL173069.1:964592:978353:1 gene:ENSXETG00000007921 transcript:ENSXETT00000017367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQCGESAGKVPASSRDGDSDSALSLDSSVFCSDYFPAPKDHLTINVGGSRFILSHKVLSN
HPETRLGRLVSSGGQEVYELCDDANLMDNEYFFDRSSQMFKYIMNFYKTGHLHVMEELCA
VSFLQEIQYWGIDELNIDLCCRERYYRKKLMSESLDIKKDEEEIEAEEEDFSGVVFEHFR
QTLWDILEKPGSSVAAKTFGTLSMTFIVISIANMVLISSEMNSIDPPLLNALEYICITWF
TLELALRFLCVKHKCRFLRSVVNIIDIVAILPFYITLIVENLYGESTELENVGRIVQSLR
LLRSLRMLKLGRHSTGLKSLGMTIAQCYEEVGLLLLFLSVGISIFSALEYAVEHNIPDTT
FTSVPNAWWWATTSMTTVGYGDIRPDTTFGKIVAFLCILSGILVLALPIAIINDRFAACY
FTLKIKEAALRQREALKKLMKNISAESDTNVNLRDIYAKSVMEMLRLKSRERASTRSSGG
DEFW
Download sequence
Identical sequences F6V1D8
ENSXETP00000017367 ENSXETP00000017367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]