SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000017690 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000017690
Domain Number 1 Region: 391-653
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-56
Family YWTD domain 0.0000000224
Further Details:      
 
Domain Number 2 Region: 94-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000128
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 181-219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 4 Region: 130-170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000733
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 5 Region: 4-47
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000877
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 221-257
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 7 Region: 279-400,654-705
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000124
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 8 Region: 53-93
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000017690   Gene: ENSXETG00000008073   Transcript: ENSXETT00000017690
Sequence length 823
Comment pep:known scaffold:JGI_4.2:GL172637.1:5984032:6015887:-1 gene:ENSXETG00000008073 transcript:ENSXETT00000017690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDETSSTKTTCGEDEFTCNSGHCISARWKCDGEEECPDKSDESEATCSSAKQVCAAQKF
SCGGPSNKCIPVSWRCDGERDCENGLDEKDCPTTISCTPGEFQCNNKTCLASVFVCDGVN
NCGDGSDERGCLPITCKPGEFRCGNNECILEKWLCDGQPDCDDQSDESEAHCGLKNQPQA
ITQCGEHEFRCNNGNCILLNWRCDGDEDCKDKSDEMDCHLATCRPDEFQCGDGSCVHGMK
QCNGVRDCLDSSDEAGCQSGAAHSPCEGDGRFQCKSGECIDSTKVCDGNKDCRDWSDESL
TACDINECMVNNGGCSHICRDLKVGYECDCPVGYKLMDKKTCGVLDIDECENPDACSQIC
VNYKGDFKCECYEGYEMDSVSKTCKAVGQNPYLIFTNRHELRQIDIVHRDYSRLAAQLKN
VVSLDVEVTSRMIYWCDLYYRRIYSAPLDRAADPSEHVVIINTTLHSPEGLAIDWIHKNI
YWTDSGNKTISVATADGCKRKTLFRNGLGEPRAIAVDPVQGFMFWSDWGDPAKIEKAGLN
GGDRQVLVSDNIEWPNGITLDVLGCRLYWVDSKLHTLSSVDFNGFNRKLLISSEDSLSHP
FGLAVFEDKIFWTDLENEAIFSANRLTGHEISILADNLNNPHDIVVVHQLKQPKAVNACN
QGSLPNGGCEYLCLPAPQISAHSPKYTCACPDGIALGPDMRSCEKVTVATSKPLADVTNA
IHHPEASTTDGNSDSDLSSTLTAAVIGVAVPLAVLALLCLLGYLIWRNWKRKNTKSMNFD
NPVYRKTTEDEEEEEDEIHIGRTAQIGHVYPAVSTQAVPSHEP
Download sequence
Identical sequences F6SME1
ENSXETP00000017690 ENSXETP00000017690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]