SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000018125 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000018125
Domain Number 1 Region: 55-200
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000953
Family Phosphotyrosine-binding domain (PTB) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000018125   Gene: ENSXETG00000008264   Transcript: ENSXETT00000018125
Sequence length 204
Comment pep:known scaffold:JGI_4.2:GL172761.1:68786:71172:1 gene:ENSXETG00000008264 transcript:ENSXETT00000018125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSAKSFGQGTGTSEAR
AEFRVRYVGSIERLKSEDSNSLQGPLDLINYIDVAQQDGKLPFVPPEEEFIMAVSKYGIK
VATSDQYDVLHRHALYLIVNMVCYDDGLVAGKSLLALKTKDPSQEQCSLWIYQCSSLDQA
QSICKVLSTAFDSVLLEKTQVPAE
Download sequence
Identical sequences A4II94
ENSXETP00000018125 gi|134023967|gb|AAI35919| gi|156717668|ref|NP_001096374| NP_001096374.1.99540 XP_012818075.1.99540 XP_012818076.1.99540 ENSXETP00000018125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]