SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000019115 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000019115
Domain Number 1 Region: 15-262
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.88e-73
Family Eukaryotic proteases 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000019115   Gene: ENSXETG00000008719   Transcript: ENSXETT00000019115
Sequence length 269
Comment pep:known scaffold:JGI_4.2:GL172748.1:623552:628431:1 gene:ENSXETG00000008719 transcript:ENSXETT00000019115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVPKVSWKEREDKTCMRMGQHCIFLLFLSLVSFLPYSFAGKIRNGIIGGQEAKPHSRPYM
AYLKIGMGFCGGSLIAPDWVISAAHCAGDITVILGAHNVKEPESSQQVIGVQSKHLHPEY
DDEESLPFNDVMLLKLTSKATINRYVQTIPLPTSSSDLPTGTPCSVSGWGLIDRDEVTDK
LFETNVTIVSRRLCHRYFPRLSDGMICAGSNNQIKDSSQGDSGGPLVCKEALAGIVSFGF
NHPPGVYARVGRYLDWIKKTISEHGDKNI
Download sequence
Identical sequences Q5M8H1
ENSXETP00000019115 ENSXETP00000019115 gi|56789096|gb|AAH88027|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]