SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000019558 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000019558
Domain Number 1 Region: 728-908
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.67e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 582-685
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000000837
Family WWE domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000019558   Gene: ENSXETG00000008921   Transcript: ENSXETT00000019558
Sequence length 919
Comment pep:known scaffold:JGI_4.2:GL173697.1:153764:167421:-1 gene:ENSXETG00000008921 transcript:ENSXETT00000019558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPRVSSYLTSLLCNHEGRLRRSQLGDLLQLPPEQIEQILQEEPHRFSVSGDLVLARTA
MRICPDYLKQKEEEKECDKLHLCRLYLQGKCWAARGRGNNSKGLVHVICAKVSTLREKKK
LNSIVVPTSKFLKLPDSPLGWPQVCIKYLHSTCDRENGCTRLHVCGYFTRGECNRTNCRR
SHCLLESSTDLVMKQSRHSLVSIENFQMLCVIKCNEAVNVPKKGANNGAQCGPSGAGRGR
GRGRDWRGPRRGSRSSSTPGSRCSTPDKLDAEDDEDGVFDPPSGDKEEKSAAASGPSSSV
GSTEWSSAPQPKPRILSLNRNASSESSTQEANSSRERHKATGSISKGQGANSAIISPNNH
IPTGTATGTTSVEQKVNSTTTNPGMYPTTGTTSVAQKVNSTTPQLPHLPATGAASMEQKV
NSTTTNPAMYPTTRTTSVAQKVNSTIYPPTRNTSMEQKKVNSTTTNPAMYPTTRTTSVAQ
KVNSAAIGKYAATGTTSEVNSTTTTGPGNGGSLSEICLHHIWKHCRLGNKCGEMHYHLPY
RWQENLGAGWQDFSHMDAIERAFCQPKNDSYSGVDFASMTYGPIRIRRLATPSSATRSLE
FVLTTEWLWYWQDELGTWIEYGKCNTKQVGASITSSDLESIYLADKTAVVPFQAGGQHYE
ISFKDMIQRNIKYTTQRRIRRRPKYQSSEDVQKLKGTPTRKPATYRDFLISGKFTPQGKT
KPLPCRDYYLVPVRESSHEYTQILGLFNKTMSGQTVKIQRIQNKSLWEVYQWQKVQMQKA
NPGKGVSEMQLFHGTDPSHRAAICHQNFDWRVCGTNGTVYGQGSYFARDASYSHNYSVPT
ATGRRMMFVARVLVGDYVRGDPTMKRPPLRPGSATQCYDSCVDTFYNPSIFVVFEKHQIY
PEYLLEYEPKKEEKSCCIS
Download sequence
Identical sequences F6YLN9
ENSXETP00000019558 ENSXETP00000019558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]