SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000020286 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000020286
Domain Number 1 Region: 4-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 97-163
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000785
Family Tissue inhibitor of metalloproteinases, TIMP 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000020286   Gene: ENSXETG00000009235   Transcript: ENSXETT00000020286
Sequence length 164
Comment pep:known_by_projection scaffold:JGI_4.2:GL173713.1:33928:47496:1 gene:ENSXETG00000009235 transcript:ENSXETT00000020286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPFGNITLCDPTNGDCPCKPGVAGPHCDQCMVGYWGFGEYGCRPCDCAGSCDPFTGDCIT
NLDIDWYREFPELLSVYNESQLSRTWEDEQGFSALRHSGKCECKEQVLGKPEVFCGMKYS
YVVLKVKILSAHDKGSHAEVNVKIKKVLKMSKLKILRGKRTLYP
Download sequence
Identical sequences F7DQI6
ENSXETP00000020286 ENSXETP00000020286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]