SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000020614 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000020614
Domain Number 1 Region: 401-663
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-55
Family YWTD domain 0.00000000281
Further Details:      
 
Domain Number 2 Region: 316-394,666-717
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000107
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 27-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00023
Further Details:      
 
Domain Number 4 Region: 144-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00048
Further Details:      
 
Domain Number 5 Region: 195-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000759
Family LDL receptor-like module 0.00034
Further Details:      
 
Domain Number 6 Region: 64-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.00038
Further Details:      
 
Domain Number 7 Region: 234-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 8 Region: 109-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 9 Region: 277-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000020614   Gene: ENSXETG00000009352   Transcript: ENSXETT00000020614
Sequence length 898
Comment pep:known scaffold:JGI_4.2:GL173755.1:40469:53477:-1 gene:ENSXETG00000009352 transcript:ENSXETT00000020614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKPALLPASFLLLLGLCHVSAISEVRKCDRSEFQCGDGKCIPYKWICDGSAECKDGSDE
SPETCKVVTCGADHFSCGGRLNRCIPLLWKCDGQTDCENGSDENDCTRKVCADDQFTCRS
GKCISLDFVCDEDLDCDDGSDESYCPAPTCNPAMFQCKDKGICIPKLWACDGDPDCEDGS
DEQHCEGREPIKTDKPCSPLEFHCGSGECIHMSWKCDGGYDCKDKSDEKDCVKPTCRPDE
FQCNDGTCIHGSRQCDREYDCKDLSDEEGCVNETVTKCEGPDVFKCRSGECITMDKVCNK
KRDCRDWSDEPIKECGENECMRNNGGCAHICNDLKIGYECLCNEGYRLVDKKRCEDINEC
ENPNTCSQICINLDGGYKCECREGYQMDPVTASCKSIGTVAYLFFTNRHEVRKMTLDRSE
YTSFIPRLKNVVALDMEIASNKIYWSDLTQRKIYSASMDKADNTSHHETVISSQIQAPDG
IAVDWIHGNIYWTDSKFSTISVANTEGSKRKTLFSDDLAKPRDIVVDPSQGFMYWTDWGL
PAKIEKGGLNGVDRYPLVTENIEWPNGITLDLTNQRLYWVDSKLHSLSCIDVTGQNRITV
ISDETHLAHPFGLTVFEDLVFWTDIENEAIFSANRLTGSNITKVAEDLLSPEDIVLYHNL
RQPKATAENWCESHHLGNGGCEYLCLPAPLITSRSPKFTCACPDGMHLGADMRSCVKEPV
LPETSTTTTTSAPVTTTTTTRPTTRSTTLAKITSTTSTVAPQRPKMASTTVAPPRPTTES
PKTTQRMVTERVPDRTTWEPVTHSQLAGNKFANEGVVESARSHPTALYIVLPIVILCLVA
FGGFLLWKNWRLKNTNSINFDNPVYQKTTEEDQIHIGRSQDGYTYPSRQMVSLEDDIA
Download sequence
Identical sequences F7EGG3
ENSXETP00000020614 ENSXETP00000020614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]