SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000021905 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000021905
Domain Number 1 Region: 214-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 2 Region: 281-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 3 Region: 385-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000021905
Domain Number - Region: 13-95
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00142
Family APC10-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000021905   Gene: ENSXETG00000009943   Transcript: ENSXETT00000021905
Sequence length 426
Comment pep:known scaffold:JGI_4.2:GL172655.1:4940879:5007669:-1 gene:ENSXETG00000009943 transcript:ENSXETT00000021905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPYMCNNECDANTQELAHPPDLMFDVEGRNPSTFWQSKTWKHYPKPLQVNITLSWNKTIE
LTNNVAITFESGRPEKMVLEKSLDYGRTWQPYQFYAADCLDAFRMEPKSVKDLTHSTVLD
IICTEEYSTGYAAHAKTLSFEIKDRFAIFAGPRLHNMASLYSQLDTTKNLRDFFTVTDLR
IRLLKPATGATFVDEKNLGRYFYAISDIKIHGRCKCNLHANSCTFTNNRLACDCEHNTTG
QDCDKCKKNFQGQAWSPGSYLTIPKGTANICEYSPWSFGDCYCHGHSNRCTYIEVVNTAV
CVSCRHNTRGQQCEKCKKGFHRNGSAKLDDVNVCIVCNSNRAGRVHDKCRKCSAVYVGPI
CYEWCLPIYYWLTRGTANVCDNELLRCQNDGVCYNNIRCHCPSGYTGILCEKQKCADTGD
CDSISG
Download sequence
Identical sequences F6VJA0
ENSXETP00000021905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]