SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000023736 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000023736
Domain Number 1 Region: 27-499
Classification Level Classification E-value
Superfamily Sema domain 3.79e-172
Family Sema domain 0.00000000000157
Further Details:      
 
Domain Number 2 Region: 501-549
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000772
Family Plexin repeat 0.00062
Further Details:      
 
Domain Number 3 Region: 561-639
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000275
Family I set domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000023736   Gene: ENSXETG00000010843   Transcript: ENSXETT00000023736
Sequence length 852
Comment pep:known scaffold:JGI_4.2:GL172892.1:385874:417716:-1 gene:ENSXETG00000010843 transcript:ENSXETT00000023736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFNVAFNALYLVLCTAFGAAEFGPAPRITWHLKETNLMHFHVSGISNYSTLLLSEEKDV
LYVGAREAIFAVSSLNVAEKLHEAYWKVSDEKNNECAWKGKSKQTECLNYIRVIQPLNDK
TLYVCGTNAFQPTCDYLNLTDFRLLGRNEDGKGRCPFDPAQSYISVMVDGELYSGTSFNF
LGSEPIIFRHSSQSQLRTEYAVPWLNEPSFVYADVIRAPANNPEGDDDKVYFFFTEVSVE
YEFFSKLLIPRVARVCKGDQGGLRTLQKKWTSFLKAKLICHSSENNLIFNVVSDVFILKH
SDSSEPKIYGVFTSHLNNVGLSAVCAYNVSTVEEVFAKGKYMHSATVEQSNTKWVRYNGE
VPKPRPGACINNEARAMNYTSSLNLPDMTLQFVKDHPLMDDSVSPVGNKPKLVLRDVIYT
QIVVDRVKALDGNSYDIMFLSTDKGILHKAVSQDAEMRIIEEIVLFPHLQPVQTLLLSNK
EGKRFIYAGSNTGVVQSPLAFCEKFTSCKDCILTRDPYCAWHPVKRSCVNILQDSTADGS
LIQKLNGDASQCPDSAEIQKSMKHTVKSRSTVELKCSQKSKLANLVWQFSNKTLKAELPK
YHLLEHALVIFNITDHDAGIYECVSQEEVGNIKVSQVLIKHVIELEKVPTTLKSTAHPYT
QTEAKSQITTIPAKVLDFSTWKKTTAQILTSPVAFTSVSAKIQESTTPLTEMHSKVPEVQ
IEKAMYLTKPSDCSLLIFLVLLFGLLFMILLVYNCYKGFLPNWCLRIRTFLFSGKQKAPP
DFPDCEQGVKENLVESKLTPSQYDDTQKIPHDTGYETELDYGNGTVPHTGKTDEDQPFDV
KCDLKYADSDGD
Download sequence
Identical sequences F6QEZ1
XP_012814281.1.99540 ENSXETP00000059989 ENSXETP00000023736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]