SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000023921 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000023921
Domain Number 1 Region: 1267-1532
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-54
Family YWTD domain 0.00000184
Further Details:      
 
Domain Number 2 Region: 1887-2148
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-47
Family YWTD domain 0.0000109
Further Details:      
 
Domain Number 3 Region: 3024-3241
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-46
Family YWTD domain 0.00000426
Further Details:      
 
Domain Number 4 Region: 3859-4131
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-43
Family YWTD domain 0.00000517
Further Details:      
 
Domain Number 5 Region: 1582-1839
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-43
Family YWTD domain 0.0000189
Further Details:      
 
Domain Number 6 Region: 534-779
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-40
Family YWTD domain 0.0000107
Further Details:      
 
Domain Number 7 Region: 202-464
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-36
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 8 Region: 2196-2463
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-35
Family YWTD domain 0.0000572
Further Details:      
 
Domain Number 9 Region: 3732-3848,4123-4168
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000121
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 846-886
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000072
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 11 Region: 1181-1261,1532-1576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000863
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 12 Region: 3595-3632
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000877
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 13 Region: 3553-3593
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000113
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 14 Region: 3637-3681
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 15 Region: 928-967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 16 Region: 2687-2723
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 17 Region: 1011-1048
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0000983
Further Details:      
 
Domain Number 18 Region: 24-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 19 Region: 3353-3392
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 2896-2937
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 21 Region: 887-929
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 22 Region: 3515-3554
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 23 Region: 1055-1095
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 24 Region: 972-1010
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 25 Region: 2808-2844
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 3472-3511
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 27 Region: 106-191,478-520
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000502
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 28 Region: 2766-2800
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 29 Region: 3432-3472
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 2726-2759
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000115
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 31 Region: 3395-3433
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 3316-3351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 33 Region: 2846-2885
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 34 Region: 2552-2593
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 35 Region: 2593-2632
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000563
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 36 Region: 1841-1891
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000598
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 37 Region: 2942-2980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000648
Family EGF-type module 0.026
Further Details:      
 
Domain Number 38 Region: 72-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 39 Region: 2967-3009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000203
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 40 Region: 3275-3330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000244
Family EGF-type module 0.015
Further Details:      
 
Domain Number 41 Region: 1141-1177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 42 Region: 3682-3715
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 43 Region: 2516-2554
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000785
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 44 Region: 801-845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000914
Family EGF-type module 0.029
Further Details:      
 
Domain Number 45 Region: 1106-1138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000107
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 46 Region: 2651-2682
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 47 Region: 2150-2198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000381
Family EGF-type module 0.018
Further Details:      
 
Domain Number 48 Region: 4355-4396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000048
Family EGF-type module 0.036
Further Details:      
 
Domain Number 49 Region: 4183-4220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000644
Family EGF-type module 0.029
Further Details:      
 
Domain Number 50 Region: 4258-4293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family EGF-type module 0.044
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000023921
Domain Number - Region: 4222-4256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000158
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 4294-4328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00148
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 2472-2532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0135
Family EGF-type module 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000023921   Gene: ENSXETG00000010934   Transcript: ENSXETT00000023921
Sequence length 4531
Comment pep:known scaffold:JGI_4.2:GL173158.1:646283:770880:1 gene:ENSXETG00000010934 transcript:ENSXETT00000023921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLPTVVFICRFCLPKTAGLCLSAPKTCSPKQFACKDQVTCISKGWRCDGEKDCPDGSDE
APEICPQSKISKCQPNEHNCLGTEICIPMGKLCNGHHDCSDGSDEGPFCREYAHNCTELG
CQHHCARTVTGPVCYCNTSYQLVEDGKTCKDFDECTVYGTCSQTCFNMEGSYSCSCVEGY
LLQPDNKSCKAKNEPVDRPTILLIASTQNILATYLNGAAVTTIVPTSTKQTTAMDFNYAE
ETVCWIHMGESPSQTMLNCAKIPNLKGFVEERSINISLSLHHVEQMAIDWLTGNFYFVDD
IDDRIFVCNRNGDTCVNLLDRELYNPKGIALDPTMGKLFFTDYGQIPKVERCDMDGQNRT
KLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKNRHTIIQGLLIEHLYGLTVF
ENYLYATNTDHANTQQKTSVIRVNRFNSSDYNVVTRVDKGGALHIYHQRRQPTVRSHACE
PDQYKKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGRGRPGIIR
GMDIGAKVQDEHMIPIENLMNPRALDFHAEYGFVYFADTTSYLIGRQKIDGSARETILKE
GIHNVEGIAVDWMGNNLYWTDDGPKKTISVARLEKASQTRKTIVEGKMTHPRAIVVDPLY
GWMYWTDWEEDPKESKRGKIEKAWMDGSNRNVFVTSKTVLWPNGLSIDIPNKILYWVDAF
YDRIEMIYTNGSSRKPVYEGQELNHAFGLCHYGSYLFWTEYRSGSIYRLDQVSKTVTLLR
NERPPIFEIRMYDAQQQQEVGSNACRVNNGGCSSLCLAVPGSRQCACAEDQILDDDGVTC
KANPSYIPPPQCQPGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPSDRFKC
ENNRCIPNRWLCDGDNDCGNSEDESNSTCSARTCPSNQFSCASGRCIPLSWTCDLDDDCG
DRSDESSKCAYPTCFPLTQFTCNSGRCININWRCDNDNDCGDNSDEDGCSHSCSSTQFKC
NSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPNRWRC
DGDTDCMDTSDEKNCDGETRPCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCES
LVCKSPSHTCANNTSICLPPEKLCDGNDDCGDGSDEGDLCDQCSLNNGGCSHNCTVAPGE
GIVCSCPLGMEPGPDNKTCQIQSYCAKHLRCSQRCEQEKNTVKCSCYEGWMLEADKESCR
SLDPFKPFIIFSNRHEIRRIDLNKWDYSVLVPGLRNTIALDFHLNQSTLYWTDVVEDKIY
RGKLSESGALTNFEVIIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLNGTMRTTLL
AGDIEHPRAIALDPRNGILFWTDWDSSMPRIEAASMSGEGRRTIHKETGSGGWPNGLTVD
YLEERILWIDARSDAIYSAKYDGSGLIEVLKGNEYLSHPFAVTLYGGEVYWTDWRTNTLA
KANKWTGHNVRVVQRTNTQPFDLQVYHPSRQPQAPNPCAANDGRGPCSHLCLITYNQSFS
CACPHLMKLSPDKKTCLEFRNFLLYARQMEIRGVDIDNPYYNYIISFTVPDIDNVTVVDY
DALEQRIYWSDVRTQTIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDANKK
QINVARLDGSFKNAVIQGLDKPHCLVVHPLKGKLYWTDGDNISIANMDGNDHKVLFTNQK
GPVGLSIDFIDNKLYWISSGASTINRCNLNGTGLEVIGTMKAYLGKATALAIMGNKLWWA
DHASDKMGTCNKKDGSDPRVLRQNTNQVMHMKVYDEEIQKGTNNCSVNNGDCSQLCLPTS
ETTRSCMCTAGYSLKSGQKTCEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAV
GMDFHAENDTIYWVDMGLSTISRAKRDQTWREDVLTNGIGRVEGIAVDWIAGNIYWTDQG
FDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQHPRIERSRLDGSERSI
LVQTSISWPNGVSIDYEEGKLYWCDARTDKIERIDLETGKNREVVLSSNNMDMFSVSVFE
DYIYWSDRTHANGSIKRGNKDNATDSVSLRTGIGVQLKDIKVFNKDRQKGTNICAVNNGG
CQQLCLYRGNNNRTCACAHGMLAENGLNCRNYDGYLLYSERTILKSIHLSDESSLNAPVK
PFEDHEHMKNVIALAFHYRESSQGGIRIFYSDIHFGNIQQINHDGTGRKTVVENVGSVEG
LAYHRGWDTLYWTSYTTSTITRHTVDQSRLGAYDRETVVTMSGDDHPRAFVLDECQNLMF
WTNWNEQHPSIMRATLTGGNVLIIIDKDIRTPNGLAIDHKSEKLYFSDATLDKIERCEYD
GTKRYSILKTDPVHPFGLAVYGEYIFWTDWVRRAVHRANKYLGSDLKILRGDIPQQPMGI
IAVANDTNSCELSPCQTNNGGCQDICVLTAEGRINCTCRGDRIIQEDFTCKSPNSTCNMY
DEFECGNGDCINYSMTCDGVPHCKDKADEKLSYCRTRHCRKGFKHCMNGRCISSSSWCNE
LDDCGDNSDEIACKKTNCTSEEYRCRDGTCIGNSSRCNQFIDCEDASDEMNCNITDCSSY
FKLGVKGVTFKNCERTSLCYAPSWVCDGSNDCGDFSDEKNCPGVRKPKCPVNYFACPNGH
CIPMSWTCDKESDCENGADEMHCDKFCTSMQFECSNHRCISKHWVCDGSDDCGDKSDEGA
ICQSNTCSPESFRCPSTHVCIPRRWLCDGDIDCQDGADESVNVGCLFNNTCDAKEFMCQN
RQCIPKQFVCDHDADCSDGSDESPECEYPTCGPDEFRCANGRCLVNKQWECDGEFDCHDK
SDEAPKNPRCTNTESKCNETFFLCKNGTCIPDNLLCDNNDDCGDGSDELNCFINECLNRK
LSGCSQECEDQKIGYKCRCRPGFRLKDDGKTCVDMDECTTTYPCSQWCLNTLGSYRCLCI
EGYEARDNNSNSCKVSASADVEEPFLIFANRYYLRKLSLGGTNYTLLKQGLNNAVALDFD
YREQMIYWTDVTTQGSMIRRMHINGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDT
IEVSKLNGAYRTVLVNSGLREPRALVVDVQHGFLYWTDWGDNSLIGKIGMDGTNRSVIVD
SRITWPNGLTLDYVNSRIYWADAREDYIQFANLDGTNRHTVISQDIPHIFALTLFEDCIF
ARACPVKKLCLIALSGLYTNDCNILQKKPQGQVPNHPCKMNNGGCSNLCLLSPNGGYKCA
CPTNFYLGADGKTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCGDRSDEPSDCPEFKCRP
GQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQ
DNCGDGDDEKDCPEVTCAPNQFQCAVNKRCIPRVWVCDRDNDCVDASDEPDNCTQMTCGV
DEFRCKDSGRCIPARWKCDGEDDCGDSSDEPKEECDERTCEPYQFRCKNNRCVPGRWQCD
YDNDCGDNSDEETCTPRPCSESEFSCANGRCIAGRWKCDGDHDCIDGSDEKDCKVRCEPD
QFQCNNGHCIPHRWHCDADADCMDGSDEENCHNTVRTCPMDEFQCHNTLCKPLAWKCDGE
DDCGDNSDEKPEECLKFTCPPFRQFRCRNDRVCLSMARVCDGIDNCGDGTDEEHCGMQDT
KPKSCDMEKEEFQCKNNKCISSSRRCDLFDDCGDGSDEESCYPDLKINGCHGNSTICGEE
MKCVHTQTTVYCTCQNGFQKIPGSNACKDINECLTFGTCSQICNNTKGSHMCTCAKNFIK
STNHSCKADGKRSNQVLYIADDNEIRSLYPFNPNSAYEQAFRGDENVRIDAMDVYVKGNK
IFWSNWHTGKISYRELHSTSSTSSNRNKRQIDEGVTDLNIPGLKMPRGIAIDWVAGNIYW
TDSGRDVIEVAQMKGEHRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGT
LRETLVEDNIQWPTGLAVDYYNERLYWADAKLSIICSIRLNGTDPVVAISNKKGLTHPFS
IDIFEDYIYGVTYINNLIFKVHKFGHGPITNLTWGINHVTDVVLHHQYKQPEVTNPCDRK
KCEWLCLLSPSGPVCTCPNGRRLDNGTCMLIPSPTLSPDASTPESCTLECLNGGKCFLNA
RKQPKCRCSSSYDGERCEIYQCRDYCKNGGICAPSLTGMPTCRCPNGFTGSQCQQEVCTS
DHCQNNGSCTVNQGNQPNCRCLPDYTGDKCQYRKCKGYCENGICQMLANGTKQCRCNPEY
EGTKCEIHRCSRCKDGKCDTRNGEVICSCLDGRIAKTCLTCDNYCLNGGVCTMNRQTDMP
ECQCPAEMTGPTCNVFVGVENRSSSTVSIVIPIVLVILLVLLVMVGAYFWYRHRMSGAKG
FQHQRMTNGAMNVEIGNPTYKMYEGEQDDDGGDLLDADFTLDPDKPTNFTNPVYATLYMG
AHNSRHSLASTDEKRELLSRGGEDDFSDPLA
Download sequence
Identical sequences F7EEE7
ENSXETP00000023921 ENSXETP00000023921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]