SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000025005 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000025005
Domain Number 1 Region: 42-505
Classification Level Classification E-value
Superfamily Sema domain 1.83e-129
Family Sema domain 0.0000209
Further Details:      
 
Domain Number 2 Region: 1355-1482,1678-1867
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.16e-53
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 960-1040
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000014
Family Other IPT/TIG domains 0.05
Further Details:      
 
Domain Number 4 Region: 861-955
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000028
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 5 Region: 508-560
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000209
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 1041-1144
Classification Level Classification E-value
Superfamily E set domains 0.000000000000431
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 
Domain Number 7 Region: 1141-1229
Classification Level Classification E-value
Superfamily E set domains 0.0000000364
Family E-set domains of sugar-utilizing enzymes 0.099
Further Details:      
 
Domain Number 8 Region: 810-843
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000419
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000025005   Gene: ENSXETG00000011446   Transcript: ENSXETT00000025005
Sequence length 1897
Comment pep:known scaffold:JGI_4.2:GL172647.1:2297776:2649961:1 gene:ENSXETG00000011446 transcript:ENSXETT00000025005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNMASTRWSWINIVTQIAFVTTVSALTRQSIQTKLNFTSFYAQHSDWTFNHLVVDVRSGH
IYLGAVNRIYKLSEDLKILVTHQTGPSEDNPKCYPPSIVQPCNDQLVLTNNINKMLLIDY
KENRLIACGSLYQGICKLLRLDDLFKLGEPSHKKEHYLSGVNESGSVFGVIVSHNNLDDK
LFIATSVDGKPEYFPTISSRKLTKDSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDFDI
YYIYGFNSGNYVYFLTLQPEMTFPPGSATKEQVYTSKLVRLCKEDTAFNSYVEVPIGCEK
NGVEYRLLQAAYLSKAGSILAKSLGIKPGDDILFTIFSKGQKRKLNSLDESALCVFVLKD
INNRIKERLQSCYKGEGTLDLAWLKVKDIPCGNALITIADDFCGLDMNAPLGVSEMVRGL
PVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGTESGAVQYETIQVVDSGPIL
RDMAFTKNEEQLFIMSDKQLTRVPVELCGQYTTCSECLGSGDPHCGWCVLHNTCTRKERC
ERSHEPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLEAYNVPELSAGVNCTFEDLSEMD
GLVVGNQIRCISPAEKEVPRIITENGKHGIVIITLVQLQLKSKETGMTFASTNFVFYNCS
VHNSCLSCVESPYQCHWCKYRHVCTHDPRTCSFQEGRVKMPEECPQLLQTEKILIPVDVV
KPITLKAKNLPQPQSGQKGYECVLNIQGNEQRVPALRFNSSSVQCQNTSYSYEGMEIDSL
PVELTVVWNGDFSIDNPALNKVHLYKCGAKRPSCGLCLKADADFQCGWCAAESKCTLKQH
CLPLESQWLELSGTHGKCANPRITQITPVTGPREGGTKVTIRGENLGLEFWEIENDVKVA
EVKCTPLIEEYIPAEQIVCEIGDAKPSQHAGFVDVCVGICRPRYMAKSSLLYYFVTLSLS
RLEPSQGPVSGGTQVTISGTNLSAGSSVKVMFGAQPCIFDRRTATEIFCNTTASPNLGKV
KVTVQIDKAKIAQELLFEYVEDPKIIKMEPEWSIVSGNTPISVWGTNLDIIRNPRIRAKL
GGKEHINNCTVLNSTEMTCQAPALAINSNHQNEFIERPEEFGFILDNVQALLVLNKTNFT
YYPDPVFESFTPSGILELKPGTPIILKGRNLMPPVAGGNMKLKYSVFVGDKPCTVTVSDV
QLLCESPNLTGRHKVMARVGGMEFSPGMVYITPDSPLSLPAIVSIAAAGGLLIIFIVAVL
IAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDY
RTYTMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRS
FSMRDRGNVASLIMTVLQSKLEYATDVLKQLLSDLIDKNLESKNHPKLLLRRTESVAEKM
LTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDSITGEARYSLSEDKLIRQQIDY
KTLVLNCVNPDNVNSPMIPVKILNCDTITQVKEKILDAIFKNLPCSLRPKAADMDLEWRQ
TNGARMILQDEDTTTKIENDWKRLNVIVHYQVLDGSVVALVSKQVTAYNAANNSTVSRTS
ASRYENMIKYTGSPDSLRSRTPMITPDLESGVKVWHLVKNHEHGDQKEGDRGSKMVSEIY
LTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHT
WKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNK
LLYAKDIPSYKNWVERYYSDIAKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIYSYV
GKYSEEILTALDQDDQAGKQKLAYKLEQVIALMSIDS
Download sequence
Identical sequences F7EI43
ENSXETP00000025005 ENSXETP00000025005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]