SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000026113 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000026113
Domain Number 1 Region: 236-345
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.18e-22
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000307
Further Details:      
 
Domain Number 2 Region: 29-83
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000117
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00097
Further Details:      
 
Domain Number 3 Region: 404-457
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000118
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000026113   Gene: ENSXETG00000011937   Transcript: ENSXETT00000026113
Sequence length 457
Comment pep:known scaffold:JGI_4.2:GL174534.1:95:13138:-1 gene:ENSXETG00000011937 transcript:ENSXETT00000026113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGGPKAAVRQQDNVSSSLLLPQENQKVFQLLGRKCTTLATTVVQLLVVQGGDRWAKQF
LGVLCLVKDNPRRSYYFQLFDLQVSTRAPYRAEKLTIKAPVLLLFYSLSFYRVGLRVALQ
VPPPATSPNPPTAGAHKFTAWVEGAPARVGSGPPAPTRTVAQSDPSPQARGLSHVSSGPS
SPQPLAPSQSLNMPAVSIPNPDIISARYRALSAPADKGKNKKGKKKFSKADIGAPSGFKH
VSHVGWDPNRGFDVNQLDPDIRNLFSRAGISDAQLKDAETSKLIYDFIEQQGGVEAVKNE
MRRGETAPPPPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTAR
SGGPPPPPPPPPSIPAPPPTSGPAPPPPPPVSGTQSIPSPTPSGGRGALLDQIRQGTKLN
KLTVSAEPPPSPQPSSEGLVGALMHVMQKRSKAIHSS
Download sequence
Identical sequences F6ZC04
ENSXETP00000026113 ENSXETP00000026113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]