SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000026675 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000026675
Domain Number 1 Region: 10-298
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.92e-48
Family WD40-repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 1006-1064
Classification Level Classification E-value
Superfamily HMG-box 0.000000017
Family HMG-box 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000026675   Gene: ENSXETG00000012210   Transcript: ENSXETT00000026675
Sequence length 1125
Comment pep:known scaffold:JGI_4.2:GL172883.1:1293627:1342581:-1 gene:ENSXETG00000012210 transcript:ENSXETT00000026675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAIKKNMRYGHPEGHTDVCFAESGNFLVTCGSDGDIRIWESLDDDDPKSISIGEKAYSF
ALKNEKVVTAASNNAIQLHTFPDGEPDGILTRFTTNANHVVFNSDGTKIAAGSGDFLVKV
LQVEDSSQQKTFRGHGAPVLSVSFDPKDIYLASASCDGSVRIWKITDQTCEAVLPLLEKC
NDVFSAKSICRLAWQTKSGKFLAIPVGKTVHLYERDSLKNSCTLSDDFITQPVNIVAWSP
CGQYLVAGSVDGCIVAWNVATKACLERIKHEKGYTICGLAWHPHMSQVAYTDNEGNLGLL
EDVCQGEGKQPNAKISSSDTKDYDELFDGDGDDEDFLNGDMIGHEGAINDEDDDNFTALT
GRQRNRGALFDDDDNSSDVPSLKPTGNENPEVEDDQTSSVQNFTSVASVKSSYNGPMPTL
QQKPFQSGSTPVHLMHRFMVWNSVGVIRCYNDEQDNAIDVEFHDTSIHHAIHLTNTLNHT
LADVSQEAVLLACESTEELASKLQCLHFSSWDTSKEWIVDMPKGENIQAICLGQGWVACA
TNALLIRIFSVGGVQKEMLSLFGPVVCMAGHGDQLIVVYQRGMGFDGDQCLGVQLLELGK
KKKQVLHGEPLPLSRKSYLSWLGFTAEGTPCYVDSEGIVRLLNRSLGDTWIPVCNTREHC
KGKSDHYWVVGIHENPQQLRHRCIPCKGSRFPPTLPRPAVAVLPFNLPYCQITTEKGQME
EQYWRSQIFTNHLDYLSKHGYECDENVKSEAQKMQQELLMKMFALSCKLEREFRCMELAE
FMTQPVMSLAIKYASRSKRLILAQRLSEMAQEKAAELASAEQQDDAEDEDFRRRLNAGYS
RTATEWGDSRAKPVKQDQLESNTSAINRKPKTMQPPTNPFNKSAKSPDISKSGAILSSNQ
GRVNPFKVSASQKSPAIAGSSSRSTSILDNMGKFSRKPSSSGSPSTTKTDSLVIKPLAPK
AKPRQLSSVLYFEGQATLFQSVQAKPAAKKTEEKITVPTPPKAAAEITENKKPKTGFQLW
LDENRQSILSENSMLEESEIIKEGMSRFRMLAPEERMLWTEKAKGDPSGEDGADAKKRKR
QEQENLASNGCHQENTDSIVAAAKKHKPVGQSANNKLSAFAFKKD
Download sequence
Identical sequences F7AJC6
ENSXETP00000026675 ENSXETP00000026675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]