SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000026914 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000026914
Domain Number 1 Region: 218-459
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.91e-51
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 64-176
Classification Level Classification E-value
Superfamily POZ domain 7.06e-28
Family Tetramerization domain of potassium channels 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000026914   Gene: ENSXETG00000012308   Transcript: ENSXETT00000026914
Sequence length 508
Comment pep:known scaffold:JGI_4.2:GL172684.1:483437:500502:1 gene:ENSXETG00000012308 transcript:ENSXETT00000026914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLGENSDYDYSALSCASDTSFNHNFFGESETLKGIFYKRAKLIQPTEDLFKSAHPDDR
KHHAIINVGGFRYLLPWTTLEEFPLTRLGQLKLCSNFDEILSICDDYDVTCNEFFFDRNP
GAFRTILTFLQVGKLRLLREMCALSFQEELLYWGIEEDNLEWCCKRRYIQKMEEFAELNL
REEELIENENASEPEDESKLDICMRHLGDMVEKPQSGLPGKIFACLSVLFVTITAVNLSI
STMPDLREEEEKGVCSKMCYNIFIVESVCVGWFSLEFLLRFIQAPSKFAFIRRPLNLIDI
VAILPYYITLVVDNTSDGQKKPGSGNSYLDKVGLVLRILRALRILYVMRLARHSLGLQTL
GLTARRCTREFGLLLLFLCVAIALFAPLLYLIENEMADSQEFTSIPACYWWAVITMTTVG
YGDMVPRSIPGQVVALSSILSGILLMAFPVTSIFHTFSRSYIELKQEQERLMCRKAQLLM
KTKSQMSSISQGSDMLSESASSGAKANN
Download sequence
Identical sequences A4IIL3
NP_001096675.1.99540 8364.ENSXETP00000026914 ENSXETP00000026914 ENSXETP00000026914 gi|134024248|gb|AAI36067| gi|157073921|ref|NP_001096675|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]