SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000027400 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000027400
Domain Number 1 Region: 493-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000419
Family Laminin-type module 0.00031
Further Details:      
 
Domain Number 2 Region: 57-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000181
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 3 Region: 2-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000204
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 4 Region: 112-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 611-692
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000314
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 6 Region: 452-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000628
Family Laminin-type module 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000027400
Domain Number - Region: 354-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family EGF-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000027400   Gene: ENSXETG00000024668   Transcript: ENSXETT00000027400
Sequence length 1151
Comment pep:known scaffold:JGI_4.2:GL172923.1:578662:599205:1 gene:ENSXETG00000024668 transcript:ENSXETT00000027400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCNCNGRSQQCVFDPDLLAQTGSGFRCINCNGGTDGPHCEHCIEGYYPQPDGTCGPCLCH
TVGSLNQQCDNNGQCRCKPGVMGSKCDQCQPGFHSLSDTGCSQFSLLWRDGCQCEAAGSS
GSCDAGGRCVCKPTVTGERCDRCKPGYYHLDGSRPEGCLQCFCHGHSATCSSSSLHSVHK
IISSFQKDTEGWSSVQRDGSTAPVPLRMSRHQKEVYIASRQQEPLYFNAPAQFLGDQSLS
YGQALSISFRVDRGRYRAGTEDLVLEGNGLRVTATLTSSKNSLPCRIPQTYTFRLDELSR
SPWTPHLSHFDFRRLLRNVTSIHIRATYGEYSTGYLQNVTLISARPVQGEPAPWVEQCVC
PSGYQGQFCERCARGYRRESPGLGALSSCVSCNCPGGGHCDPDTGDCYSGDENQNNDCAD
CPQGQYNDPRDPMSCLPCPCSAGIGCSLSPETQEPVCDECPVGLNGPRCEICAEGYFGDP
QGERGAPRPCRPCQCNNNIDRSVEGSCDRVTGECLKCIHNTAGYYCDRCKDGFFGNPLAT
APELKCKACYCHPVGTVHQGCQKDGSCQCKTGFEGRSCDQPQCPDCYSQVSTKLNLYKRQ
LLKLTGENNGQSPARGELEERMRKAEAAAQGLQRDSEAANGAALSLQRQFSGLQGTQSDT
QNVLDQAKEKLQGLQTQKNQYQGQLQDMGRKINIALQQLQGSQEELNRMTFPSTNLPLDS
GSYSKLRQEAQEIANRLAQEAQTVAQDAAEAQGDTERALQILRTGGADPETADKLKARLY
VYRMEEARTQARSLETEAIQAAAAAERAHHDSMQTARAFGQLPPITSVAFQAKKAQNIIQ
DTVCLSDLFYVHQAELERLKGESTALKTNVDADLAQLADQLLSRANAAKTKATQAMNTGN
ATFYEIDGILMSLKGFGDQVGDRRSEAEDAMRRLPEIRLRVQDATDSTKRTETALKGAAS
DASRAEGNAREANNIASEIQLNMLQMSQDANNSAEMALALERDLAEIRRLAIDTGASLDG
KNQAAERDSAVADEVARKALEAEASALGVHDAVTATLSTLDRMLHILDQPLNINEEGLKA
LEASMGAARTQLNGRLKPAVQDLELAAQLQKQNMITVEKEISQTLIDIQNLRDIRDNLPP
GCYSTTAIEKP
Download sequence
Identical sequences F7BKR3
ENSXETP00000027400 ENSXETP00000027400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]