SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000029043 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000029043
Domain Number 1 Region: 216-456
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-50
Family Voltage-gated potassium channels 0.0017
Further Details:      
 
Domain Number 2 Region: 61-174
Classification Level Classification E-value
Superfamily POZ domain 1.13e-26
Family Tetramerization domain of potassium channels 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000029043   Gene: ENSXETG00000013259   Transcript: ENSXETT00000029043
Sequence length 505
Comment pep:known scaffold:JGI_4.2:GL172756.1:2116503:2147275:-1 gene:ENSXETG00000013259 transcript:ENSXETT00000029043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIISGNSEQDYNNLSYSSSSTLNHFFPIAVESQTIKGVRYQRAQRIYDTDGVYTADLKR
EIIINVGGIKYLMPWSTLDEFPMTRLGKLRFCSSYEEIIQICDDFDEDTNEFFFDRNPCA
FSMIVSFLAAGKLRLLREMCALSFQDELTYWGIEESKLERCCLRKLFQKLEELAEIRKEE
EAQRNRETICVLEDNTKVGHCMGKLRDMVENPQSGIPGKVFACLSIIFVATTAINLCVST
MPDLRAEEDRGECSQMCYNIFIIETICVAWFSLEFFLRFIQAKSKCQFFKGPLNIIDVLA
ILPYYVSLIVEDEQKTVDKPSSNSYLEKIGLVLRVLRALRILYVMRLARHSLGLQTLGLT
VRRCTREFGLLLLFLCVAVTLFAPLVHLAENEMGRCQEFTSVPASYWWAIISMTTVGYGD
MVPRSIPGQVVALSSILSGILIMAFPATSIFHTFSRCYSELKREQERLQSRLMRLKDANQ
SGESDTFNDTDSLVSEEAYKYFYNG
Download sequence
Identical sequences F6Y7C6
ENSXETP00000029043 ENSXETP00000029043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]