SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000029746 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000029746
Domain Number 1 Region: 179-408
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.63e-57
Family Voltage-gated potassium channels 0.00077
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.1e-32
Family Tetramerization domain of potassium channels 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000029746   Gene: ENSXETG00000013577   Transcript: ENSXETT00000029746
Sequence length 653
Comment pep:known scaffold:JGI_4.2:GL172671.1:3773651:3992064:-1 gene:ENSXETG00000013577 transcript:ENSXETT00000029746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDEVIILNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEETKEYFFDRDPEVFRCILNFYRTGKLHYPRYECISAYDEELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNEFENNQEAMPSLTLRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGTVPGNKELPCGERYDVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFMRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSSSKFTSIPASFWY
TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR
AQKKARLARIRVAKTGSSTAYLHSKRNGLLNEALELMGSTEEPHIGKSASLIESQHHHLL
HCLEKTTGLSYLVDDPLLSVRTSTMKNHEFMDEQMFEQNCRESSMQNYPSSRSPSLSSNH
GLTTSCCSRRNKKTTHLPNSNVPATRLRSMQELSTIHIQCSDQPSLTASRSSLNLKSDDE
LRSNCKASQITTAIISIPTPPALSPEGETRPGSPPGRSTNIHSTSNIVKVSAL
Download sequence
Identical sequences A4IIK9
gi|134025642|gb|AAI36063| gi|156717742|ref|NP_001096411| ENSXETP00000029746 ENSXETP00000029746 NP_001096411.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]