SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000031145 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000031145
Domain Number 1 Region: 2-487
Classification Level Classification E-value
Superfamily Sema domain 8.24e-191
Family Sema domain 0.0000000000000177
Further Details:      
 
Domain Number 2 Region: 483-535
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000558
Family Plexin repeat 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000031145
Domain Number - Region: 593-636
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00023
Family I set domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000031145   Gene: ENSXETG00000014232   Transcript: ENSXETT00000031145
Sequence length 740
Comment pep:known scaffold:JGI_4.2:GL172774.1:1888489:1967749:1 gene:ENSXETG00000014232 transcript:ENSXETT00000031145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVLEMLESNNLITFNGWPNSSSYHTFVLDEERGRLYVGAKDHIFSFNLANVKEFQKILW
PVTNIRRDECKWAGKDIMKECANFIKVLKVYNHTHLYACGTGAFHPVCTYIDVGNYPEDN
IFKLEDSFFENGRGKSPYDPKLLTASILIDGELYSGTAADFMGRDFAIFRTLGNHHPIRT
EQHDSRWLNDPRFIGAYLVPESDNPEDDKVYFFFRENAIDGEHTGKATHARIGQLCKNDF
GGHRSLVNKWTTFLKARLICSVPGPNGIDTHFDELQDVFLMNSKDPKNPVVYAVFTTSSN
IFKGSAVCMYSLADIRRVFLGPYAHRDGPNYQWVPFQGRVPYPRPGTCPSKTFGGFDSTK
DLPDEVIMFARSHPAMYNPVFPINNRPIIIKTEVDYQFTQIVVDRVEAEDGQYDVMFIGT
DMGTVLKVVSVPKETWHDLEEVLLEEMTVFREPTAISAMEISTKQQQLYIGSSVGVSQLP
LHRCDVYGKACAECCLARDPYCAWDGSSCSRYFPTAKSRRTRRQDIRNGDPLTHCSDLQH
QARFSHSCIFRVLVYIFHSCIYSKNDEREQKQLLHYWLLKLTHQYRTELIKVDERKIKTE
HGLLLRTLKKRDSGIYYCSAVEHGFMQTLLKVTLEIIDTEHLDELLHKEDEGDSHKHKEP
SNSMSPTQKIWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQKNGNVQVSNTKWKHLQ
ENKKGRNRRTHEFERAPRSV
Download sequence
Identical sequences F6XF66
ENSXETP00000031145 ENSXETP00000031145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]