SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000032296 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000032296
Domain Number 1 Region: 887-1082
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.77e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000398
Further Details:      
 
Domain Number 2 Region: 685-805
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-24
Family Pleckstrin-homology domain (PH domain) 0.0000375
Further Details:      
 
Domain Number 3 Region: 30-157
Classification Level Classification E-value
Superfamily PDZ domain-like 1.54e-19
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000032296   Gene: ENSXETG00000014740   Transcript: ENSXETT00000032296
Sequence length 1406
Comment pep:known scaffold:JGI_4.2:GL173207.1:323179:350411:1 gene:ENSXETG00000014740 transcript:ENSXETT00000032296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADCPVPIPPLPVPFLLQTPVVPRDGGCPSTSPPLDESFHWVGPRTLVIRKSQHGFGFTLR
HFIVYPPESAVTSVHKEEDGGAVTDLPSAASQLEPMDTIFVKQVKEGGPAQKAGLCTGDR
LVKVNGESIIGKTYSQVIALIQNSDDTLELSIMPRDEDILQLAYSQDAYLKGNEPYRGGA
HSIPEPPPVYYPWRTHEPVSGYAPASRYHHPNSADATAIRSPVHSEVPRGSPAHRDNYPR
TAPTSLSQARSFQGSPSSSDAPRNVSPEPWERLASPRWVSPWERHQALCSWMSQQAPRRG
SALPPRRRSASQDRLGETTHLSNWPHSVSQDTLHQAPLYESWGHRAQSDNFLAQFGTSAE
KLNLSALISPPYEHRIWPQDRPLHSSQAPSRVRPSQTVSPGLREATKPPQPHPSSGDSGY
IGYRSYSPSFQRRTELLNAFSFRETAFSGLPTFRTEQYSGSPASLPERRESAVSASSTDD
SCSTQERREEVVLRQKPPSGRKATTAVRQVNLHFPTEVNEEAPRERPLQRVPPLPPSEEP
LASIPFIDEPTSPSIDLRAKHVPASCVVSSAINSAPVISASPSSPSFSFNISRHYSQDCS
SIKSSRRSSYLLAITTERSKSCDDGLNTFREEGRLQRRVVGRVPSLRMLRSFFTDGSLDS
LEANEDGRSKRHSASELSETEFSDVRREGWLLYKQILTNKGKKVGSGLRQKRVFAVLRPH
LLFLHKDRPEARGPAPGEEEQPISILGSLVDISYSETKRKHVFRLTTPDFCEYLFQAEDR
DDMLSWVKAIRENSRMEGEDPGFASQALINKKLNDYRKVSITGVKQETSPKGSRSLGIRP
DLLWTSGVSAPRSPKQDGAAKAEEAPPSKGAWGINLMKKNKKCPPRAFGVRLEDCQPAAE
NKGVPLIVELCCSQVEQKGLEYLGIYRVPGNNAVVSSLQEHLNKGLSESNIQDQRWQDLN
VVSSLLKSFFRKLPEPLFTDDKYSDFIEANRMEDSRERMKMLRKLIKELPSYYYETLRFL
VRHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTHMPDRYKIVETLIQHFDW
FFSEEQEKAEKTPVDETNSQNIPNIEHLLPNIGRTAGTGENSDSTNSDSAKGKGSWVSRK
EIYARDILSIPFISAVNRKRRKRRDEKRFGSSTEEDDSEQEAARAGQVEQKAEAEVELRE
TEESPAQTCSPHGPGERIPVDARSIVSGYSTLSTLCSEPASSVRGGEEADDERSEFSHME
TDTEGVGARETDERPHSQDSFTSQRLIPGDTLARRRLGRGRIESKEEPAPPRNSLRIRPA
ADDLCVAALRKPGSPETRRRKSAWRRHTVVLPGQLTDCNFNDWKEPVPGATVASEPGSRL
SGGAWVEGRDSGLSSLESQKAKTSVA
Download sequence
Identical sequences F7DPW7
ENSXETP00000032296 ENSXETP00000032296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]