SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000034216 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000034216
Domain Number 1 Region: 620-793
Classification Level Classification E-value
Superfamily PH domain-like 3.96e-36
Family Phosphotyrosine-binding domain (PTB) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000034216   Gene: ENSXETG00000015685   Transcript: ENSXETT00000034216
Sequence length 806
Comment pep:known scaffold:JGI_4.2:GL173493.1:13807:49433:1 gene:ENSXETG00000015685 transcript:ENSXETT00000034216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRAEMFSLSTFHSLSPPGCRPSQDISLEEFDDEDLSEITDDCGIGLNYDSDHCDKEGL
GFGRCDPSRALCSFQEDFQEFEMIQENIKQIEAPPSPSPSPLPLEDSLKNRPSTLGITAP
RTQDTLNNNGGFISQRESWPDPERNETDLDSQSEITQPEQDSCQVSDSDNTVTELEMSSP
PMVVSSNETTSPSSDPGIEADLTSHGRYLSSGHCSQDLSSPGSDSDVEAGRLVGNMISSI
SETELDLSSESSSGRSSHLTNSIEEASSPTSDPEEEPAKNTERSLESLRRSFYLPVGPKL
MPEPDANSEYESDSESEADLSEDSDSPWLLSNLVNKMISEGSYPITCPDECFQRQTSPSC
DTLSPASDLDPEAVEPDLEKLETTDQSIELVDMETLQNSLNHLEKEDAGPALYVMHDSCD
TVTPIYSAAGRTPKPNSQFCLVLVKPDANSEYESDSESEADLKENFLEPPLTETRLMDDS
LAYDSVKYTLVVDEHTQLELVSLQRCTSILSDGSDLLTTCNPCDLEEDDFGDEVDAQEQE
SSSGDSSPEPNMPFSKKFLNVFVNSTSRSSSTDSFGLFSCVINGEEREQTHRAVFRFIPR
HEDELELDVDDPLLVECEDGSWCRGYNMRTGERGIFPSFYAHEVVCPVKENVVLRGNSPW
VQMFDAQFLGSVEVPNHQGNGILCAAMQKIATARKLTVHLRPPASCELEISLRGVKLILR
GNDRPEDERCSHFFQMKNISFCGCHPRNSCYFGFITKHPVLNRFACHVFVSQDSMRRVAE
CLGRAFQEFYQENVEFSCPTEDIYLE
Download sequence
Identical sequences F6ZQD2
ENSXETP00000034216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]