SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000034720 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000034720
Domain Number 1 Region: 111-168
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-18
Family ZZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 399-447
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000393
Family UBA domain 0.00037
Further Details:      
 
Domain Number 3 Region: 15-99
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000157
Family PB1 domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000034720   Gene: ENSXETG00000015913   Transcript: ENSXETT00000034720
Sequence length 452
Comment pep:known scaffold:JGI_4.2:GL172914.1:798090:805823:-1 gene:ENSXETG00000015913 transcript:ENSXETT00000034720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTVKAYLLGKDESHREIRRFQLELPAAGKEKASVSSCELLANKVTGVFQGLKGGAFQM
FYKDEEGDLVAFSTDEELHMGLSLLNEDVFRIYIKERKECKRDHRGHCGQETPQNVVHPN
VTCDGCDGPVVGNRFKCLICPDYDLCSTCEKKGIHKEHNMIMFPTPLVYPRSRWFRKMHH
GVPPFPWMQGWAYPPRGYPCQNFQQAQESTPPQNETPAEEAAATSDSQSSQNPNVAFLKN
VGESVAAMLSPLGIDVDIDVEHGGKRTKVSTSHPCSVDGDSQPNSSTSFTESQDIASRSD
SAPNLMETEHIAKRMKDIALNSPLPQDNEQGENSSSASGGDDDWTHVSSKEVDPSTGELQ
SLQLMETGQPCSLDPTRSSALPTHAPTGLREAALYPHLPPEADPRLIESLSQMLSMGFTD
EGGWLTRLLEAKQFDIGSALDAMQSIRHIPPS
Download sequence
Identical sequences F6TMS2
8364.ENSXETP00000034720 ENSXETP00000034720 ENSXETP00000034720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]