SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000034901 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000034901
Domain Number 1 Region: 185-418
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-59
Family Voltage-gated potassium channels 0.0007
Further Details:      
 
Domain Number 2 Region: 31-140
Classification Level Classification E-value
Superfamily POZ domain 5.49e-32
Family Tetramerization domain of potassium channels 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000034901   Gene: ENSXETG00000016003   Transcript: ENSXETT00000034901
Sequence length 869
Comment pep:known scaffold:JGI_4.2:GL172684.1:2954630:3100801:-1 gene:ENSXETG00000016003 transcript:ENSXETT00000034901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGWMNKHGSRSTTSLPPDPMDIIRSKACSRRVKLNVGGLAHEVLWRTLDRLPRTRLGKL
RDCNTHECLMEICDDYNLEENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELD
YWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCADKRKKLWDLLE
KPNSSVAAKILAIISILFIVLSTIALSLNTLPDLQGIDEFGQTTDNPQLAHVEAVCIAWF
TMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFR
IMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEEDTK
FKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFY
KEQKRQEKAIKRREALERAKRNGSIVSMNMKDAFARSVELMDVVVEKTDDNSGRKDKVQD
NHLSPSRWKWTKRTLSETSSNKSFDAKEQGSPEKARCSSSPQHLNVQQLEDIYNKMAKTQ
SQPVLNSKDSNQPSKPAEELEMEAIPGPTVPMLATHREGIIDMRSMSSIDSFISCTAEFP
ETGRFSHSPLAILPYKININPGQNTSHGYKQSRDVSRESFTEIPPKTDLGRHSTFILESP
KSLVKVKNPLMLRSLKVNFLEGDTGTLLPAPNVLSSTSHMQEGPSKLDTSFMSEHSVRSP
ETSLYTTASARTPSKSPEKHMAIAFTFHDANVHKYIDADTDDEGQLLDGLDSSPSKELLG
TMSPKYNITNSGHRTQRDNVHRGEKNHLESAPFSSSSRYVGQNCIYSTEGVTGRGQGNLE
TIKMENHISPEVHVLPGGGGHSNKHDPSI
Download sequence
Identical sequences F6UCC2
ENSXETP00000034901 ENSXETP00000034901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]