SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000035400 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000035400
Domain Number 1 Region: 3171-3435
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-54
Family YWTD domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 1408-1670
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-48
Family YWTD domain 0.00000467
Further Details:      
 
Domain Number 3 Region: 2361-2620
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-46
Family YWTD domain 0.0000038
Further Details:      
 
Domain Number 4 Region: 367-628
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-45
Family YWTD domain 0.00000991
Further Details:      
 
Domain Number 5 Region: 697-939
Classification Level Classification E-value
Superfamily YWTD domain 8.89e-41
Family YWTD domain 0.0000243
Further Details:      
 
Domain Number 6 Region: 1717-1980
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-40
Family YWTD domain 0.0000368
Further Details:      
 
Domain Number 7 Region: 4027-4264
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-38
Family YWTD domain 0.0000154
Further Details:      
 
Domain Number 8 Region: 2056-2308
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-32
Family YWTD domain 0.000054
Further Details:      
 
Domain Number 9 Region: 237-252,287-356,621-677
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-17
Family Growth factor receptor domain 0.024
Further Details:      
 
Domain Number 10 Region: 2706-2748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000034
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 11 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000038
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 12 Region: 3116-3164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000217
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 13 Region: 1236-1277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 1077-1114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 15 Region: 1036-1073
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 3599-3639
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000589
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 17 Region: 73-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000772
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 1117-1155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000877
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 19 Region: 2829-2869
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000089
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 20 Region: 2998-3040
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000956
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 21 Region: 2958-3000
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000119
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 22 Region: 187-228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 23 Region: 2873-2911
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 24 Region: 3769-3807
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 34-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 26 Region: 993-1031
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 27 Region: 3812-3846
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000111
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 3518-3561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 29 Region: 1200-1236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 30 Region: 3482-3517
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 31 Region: 3693-3726
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 32 Region: 153-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 2671-2715
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 34 Region: 3557-3600
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 35 Region: 3897-3934
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 36 Region: 1324-1368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 37 Region: 3725-3765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 38 Region: 2785-2831
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 39 Region: 1156-1195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 40 Region: 1990-2038
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000368
Family EGF-type module 0.015
Further Details:      
 
Domain Number 41 Region: 1354-1400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000402
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 42 Region: 3046-3086
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 43 Region: 2915-2958
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000772
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 44 Region: 3854-3892
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000969
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 45 Region: 3083-3129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000108
Family EGF-type module 0.011
Further Details:      
 
Domain Number 46 Region: 1281-1317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000109
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 47 Region: 118-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 48 Region: 2754-2790
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 49 Region: 2314-2354,2615-2679
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000565
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 50 Region: 3979-4013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000648
Family EGF-type module 0.011
Further Details:      
 
Domain Number 51 Region: 3653-3686
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000903
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 52 Region: 3941-3980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000963
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 53 Region: 1671-1713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000991
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000035400
Domain Number - Region: 951-998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 3438-3470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000035400   Gene: ENSXETG00000016214   Transcript: ENSXETT00000035400
Sequence length 4508
Comment pep:known scaffold:JGI_4.2:GL172872.1:1441134:1525384:-1 gene:ENSXETG00000016214 transcript:ENSXETT00000035400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSSGSFRCSNGRCIPLSWRCDGTADCTDNSDEAGCPPRTCSTSQFRCGDGDCITSSWVCD
DEEDCDDGSDEQHCPGRTCSAQQFTCSSGQCIPRAYRCDRMKDCTDGADERNCLYPVCTE
LSCGSGACYNRSQRCDGIVDCRDSSDESNCTQRCLSSQFQCPSGECIPRDFLCDHDDDCG
DESDEKNCTYPTCRGDYFTCSNGRCIHQTWLCDGDDDCDDNGDEWGCVLLEGGHRECGPG
EWACPSSGQCIPVDKVCDGIVHCRFGEDESNITAGRNCSTNNCASLSCQHRCHSSPAGGL
CYCPAGYVISSNDSRTCIDFDDCKMWGICDQFCEDRIGSYRCSCAEGYILEHHKHCRANS
TRGPPSIIFSNGRDLLIGDIHGGNSRILVQSHNRGVAVGVDFHFQLRRVFWTDTVQNKVF
SVDIDGSNVREVLNISIETPENLAVDWVSNKIYVVETSIKRIDMVDLDGQNRITLIAEDL
GNPRGIALDPSVGYLFFSDWGSNSEESKLERAFMDGTNRHDIIKTKLGWPAGMTLDIITK
RLYWVDSRYDYIETTTYDGLDRRTVVHGGNVIPHPYGLSIFEHYLYFTDWTKVSVMKANK
FTDNSTQVVYRSSSRPYGVTVYHSARQPYVRNPCGTNNGGCEQICVLSHRTDNGGLGYRC
RCKLGFDLHEDGRRCVVVRKFLLFSSQLAVRGIPFNLSTQEDVIIPITGVPSYFVGIDFD
AQDNAIFYSDTVKDMIYKQKTDGTGKEILTANRVEGVEDLAYDWISKNLYWTDPRYRSIS
VMKLADKSRRAIIQNLNNPRSIVVHPVIGYIFWTDWYRPAKIMRAWCDGSHLQPIVNSSL
GWPNGLAMDWSSLRLYWVDAFFDKVEHSTFDGLDRQTLNRITQMTHPFGLTIYGGYAYIT
DWRLGGIVRVRKYDGGEMTIIRRGINNIMHVKSFDASTQIGSNYCNRPTNPNGDCSHFCY
PVPNLQRVCGCPYGMRLRPDQQTCFDDPASEPPTMQCGSYSFPCANGKCVPVYDRCDGVD
DCHDNSDEANCGTRNNTCSSRAFTCGNGQCIPLNWRCDSHNDCVDRSDEQNCPTQGPRSC
SSTSFTCQNNRCIPRIWLCDTDNDCGDGSDELNCNFTSTCEPGQFQCPDHRCIDPSYVCD
GDKDCVDGSDEMGCTYNCSYSEFKCASGDQCISTGYQCDGVFDCNDHSDELNCPTRPAGM
CHQNEFQCQSDGACIPSNWECDGHPDCIDGSDEHNTCPVRSCPPSMFRCDNGNCIYRSWI
CDGDNDCRDMSDEKDCPTPPFRCPSWQWQCPGNTICINVSKVCDNTPDCPNGADESPLCN
QESCTDNNAGCTHQCIQGPFGAQCTCPEGYSLSNDSKTCEDINECLTPGFCSQTCYNERG
SYRCYCEDGYILEPNGRTCKAAGSANLLLLVASRNQIIADNITTQAHNIYPVIRDGRTIV
AIDFDSVTNRIFWSDIAQDKIWSAFVNGTDRKVIFDSGVTVTESIAVDWVGRNLYWTDYV
LETIEVSQLDGTHRTVLISENVTNPRGLVLDPRTDAHVMFWTDWGRNPRIERASMDGKMR
TVIVSNKIYWPNGLAIDYPNKRLYFADAYLDYIDYCDYDGNNRKQAMASDLVLQHPHAIT
IFEDYVYWTDRYTSRVIRANKFHGGNQTVMIYNIHQPLGISAVHSVKQPGGVNPCAFNPC
SHICLLSSIGPKFYSCACPSGWTLVSDSVNCQRDEKPFLVVVRDSIIFGMSLNPDDKTND
AMVPVAGIRNGYDVDFDDSEQMIYWIENPGEIHRVKSDGTNRTVFAPAAIIGAPVGLALD
WISGNLYYTNPRTQSIEVIKLRGEVKHRKTLITNDGTQTGAGAPIGIAVDPARGKMYWTD
QGIDGGTPAKVASADMDGSNPSVLFTNNLDHIEFITIDTAEQKLYWTVTGTGMIERGNMD
GTNRVTVVNHLSHPWGIAIHEAFLYYSDRDYEVIERVDKSTGANKVVMRDNIQGLKCLRV
HYRDNSAGSSNGCSNNPDACQQLCFPKPQGQFSCSCATGFKINADNRTCSPYSSFIVVSM
LTAIKGFSLEAADHSEAMVPMAGRGRNALHVDVHMPSGYIYWCDFSSTPGANNGIRRVKP
NGSSFRNIVTGGIGRNGIRGIAVDWVAVGNLYFTNAFLTETFIEVLRLNTSYRRVLMKTT
VDMPRHIVVDPKNRYIFWADYGQSPKIERAFLDCTNRTVLVSEGIVTPRGLAVDRTNGYV
YWVDDSLDMIARVKSEGGETEIVRYGSRYPTPYGITVFENSIIWVDRNLKKIFQASKEPS
NSEQPSVIRDNINLLRDVTVFDSRYQPTSPQELNNNPCFQNNGGCSHLCFALPGQQTRKC
GCAYGTLASDGTRCVISTDDYLIFALEGSIRSLLLDPENHSPPFPPVNVFRTAVALDYDS
LDNRVYFTQSSGAGRSRISYFSLSSPSGPRTTVASDLGAPDGIAFDWIHKRVYYSDYLNQ
TINSMAVNGSDRTVIARVQRPRAIMLDPCRGYMYWTDWGTNAKIERATLGGNFRTAIVNT
SLVWPNGLTLDYEEERLYWADANLQKIERCSLTGTNREVVVSTAVYPFAMTLYDQHIYWT
DWNTRSIYRANKHDGSDQIIMIQNLPQRPMDIHVLSKNKQQQCSSPCDQFNGGCSHICAP
GPNGAECQCPASGRWYLANNNKDCIVDNGTRCENGKFTCLNGRCIPERHKCDNDNDCRDG
SDELERVCAFHTCPSTSFTCGNGRCVPYHYRCDHYNDCGDNSDELGCLFRTCDPNTEFTC
NNGRCISRAYVCNGVNNCFDNGTSDERNCPDRTCQPGYTKCRSTNICIPRTYLCDGDNDC
GDMSDESPTHCVTLTCTESEFRCSSGRCIPGHWYCDQGVDCSDGSDEPPTCVAHVRTCSS
DQFRCDDARCIPASWICDGDNDCGDMSDEDQRHNCANRSCAPTEFTCINNRPPERRCIPQ
SWVCDGDADCSDAYDEHQNCTRRSCSSSEFACANGLCVRSNFRCDRRNDCGDGSDERGCI
YPTCQQQQFTCQNGRCISKAFVCDGDNDCGDESDELEHTCTTSEATCNPHYFKCDNWICI
AQGSVCNGNDDCGDNSDEKACGINECNDPSISGCDHNCTDTQTSFFCTCRPGYRLMSDKR
TCDDIDECSETPSVCSQICENTAGSYICKCAPGYIREPNGRNCRQNSNINPYLIFSNRYY
LRNLSLDGQSYSLILQGLSIVAALDFDRVESRLYWIDAGRRVIERMFLNGTNKETIINND
IPAGEGLAVDWIGRKIYWLDSYKDCLNVADLDGRFRKKLIDRCIDANNTFCFQYPRAIVV
HPKKGYVYWTDWADKPFIGRAGMDGKNKTVIISTKIEWPNGLTIDYTNDMLYWADAHLNY
IEYSDLDGRHRHTVYDGNLPHPFAITVFEDNIYWTDWNTRTVEKGNKYDGSGRTMLANTT
HRPFDIHVYHPYRQPITNNPCGRNNGGCSHLCLIKEGGQGYTCECPDHFLAVQFGSVVRC
LPACSSTQFLCADSERCIPIWWKCDGQRDCRDGSDEPATCPQRYCRVGQFQCNDGNCTSS
YFMCNSYPDCPDGSDEDQILCANHQCDTHQWQCANKRCIPESWQCDQEDDCGDNSDEDSA
HCSTRTCNPGQFRCNNGRCIPQSWKCDVDDDCGDHSDEPFQECMGPAYRCDNHTDFDCRT
NYRCVPMWSVCNGYDDCRDNSDEQGCEQRTCDPRGDFRCDNHRCIPLRWKCDGDNDCNDG
SDERNCSPRECTESEFRCDNLRCIPGRWICDHDNDCEDNSDERDCEIRTCHPGYFQCNSG
HCIAERFRCDGTADCLDVSDEAACPTRYPNGTYCPASMFECKNHVCIQPYWRCDGDNDCG
DGSDEELQHCLDIPCEPPFRFRCGNNRCVYRHEICNGVDDCSDGSDETEEQCRPPTPRPC
TDEEYKCGNHFCVPLHYVCDDYDDCGDHSDEAGCNRGTQRSCSENICEHNCTNLSEGGFI
CSCRPGYKASESDRNSCEDINECELYRKCPQDCKNSKGSYECFCAEGYRSVGDQQGTQCA
AEGTPPLLLLPDNVRIRRYNLSSEQYSDYIEDQQHVQALDYDWDPEGIGLSVVYYSIRGQ
GSTFGSIRRAYLPTFEDYGNNLVKDVDLDLRYIGNPDGLAVDWVGRHIYWTDAGTNRIEV
AKLDGRYRKWLIYTQIDQPAAIVVNPELGFMYWTDWGRQPKIECAWMDGQQRQVLVSEDL
GWPTGLTIDYINKNRIYWSDSKENIIESIKPDGTDRQTVITGDLGNPYSLDVFEGHLYWT
TKEKGXNFINSDCLTAVAVLLTVILVIIIGSLVIGGIFNYRRTGKLLPSLPKFPSLSGLV
KSSENGNGVTFRSGTDVSMDIGVSGFGADSAIDRVMQMNETFTVDTGKEPTVYENPMYTT
SEGAAVVTISRPPDVTNINNNGQGADNFENPLYAVDTPQSSGSLETTQPESKWNFFKRKI
KQSTNFENPVYAEMEKEQQNEAEEDPSPFTSQPPEKSSNKKEQQPSSYSPTEDTFKDTAN
LVKEDSDV
Download sequence
Identical sequences F6VEH7
ENSXETP00000035400 ENSXETP00000035400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]