SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000036248 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000036248
Domain Number 1 Region: 74-200
Classification Level Classification E-value
Superfamily TPR-like 5.42e-20
Family Tetratricopeptide repeat (TPR) 0.0034
Further Details:      
 
Domain Number 2 Region: 866-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000456
Family HkH motif-containing C2H2 finger 0.093
Further Details:      
 
Domain Number 3 Region: 913-944
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000196
Family CCCH zinc finger 0.0036
Further Details:      
 
Domain Number 4 Region: 785-817
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000563
Family CCCH zinc finger 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000036248
Domain Number - Region: 647-679
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00275
Family CCCH zinc finger 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000036248   Gene: ENSXETG00000016617   Transcript: ENSXETT00000036248
Sequence length 984
Comment pep:known scaffold:JGI_4.2:GL173342.1:53924:86287:1 gene:ENSXETG00000016617 transcript:ENSXETT00000036248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLVASGFSVRQEARSLQLIANQNCQETEDNMSHVLTIRSIRQEEIKKGLQFIQSSLPYL
GTQEDYEIFLKKLVIDLYNEGNDLYRENCAKDSLSQYTEALSIAEYASSDEICIPSKTWE
RLYVNRAACYLEMGLYEEALKDCEDVLKLNDSNLRALYRKSQALFMLERYKEAYDAVAKC
SLSAPQDESVVKLAQDIAVKLGLKIRKAYIRAKTGLNVALEEDARKNVDSLAEHIEPDLP
AFNSENPHLTFSSLSVATNSFSGTPSSSASCISPSVFPIAEVGTFPSAIASNGVSSPFSI
TCMNYGDGDILGDELDKFLDSVPGSNEINKASSAAVGLLPSSKQSISGSPVQNIPVFSGF
SSDQYSPSIISPFESMVLNSAPVTDYQDPSVLGQINGTSKTSISDTSSFTGKDSTYLFRS
DSPDILGSNLTLSLPDSLVNGAQSISYHTPLKGINPLEDTHEFRQACQFCFTKSGTSQAF
IFNSALNHKCKKDILLGRTKSSGDASWKKIRPRPKNQYLGPFYLCKDVLQGNECTYPNCT
FAYSQEEIDVWTQERMGTFCREALFGGKGKISLTIPHLLQEHPGTFVFLCGKCFDHKPRI
ISKGNMDSPFFCSHPGFKHAFQDVKCLVHINLGVTVKYSKIRPFEPNYVLDLCRHEVRYG
CLREDTCFYAHSLVELRVWVIQKETGISLDAIVQESRKSSTVESFAPRSQVLNIPSNAGY
PNAKIKFVCGQCWRNGQVIEADKNKKYCSAKARHQWSKDHRIVLVMSNERKKWIAIRPYP
AKKPAPLQFEMCNHIASGKKCQYIGNCSFAHSPEEKEIWTSMKELGIQDMEQLYEKLMKK
DTVEKADGALAQVNKQIHLPTDYAETTVDFHCWLCGKNCNSERQWKMHISSDKHKEKVFH
CEEDQNIWQHRFPTGKFSVCKRFLSGKCPDGEDCSFAHGNAELAEWRERRQVLCQKLIKA
RKDKLISPDDNDFGKYSFLINDLN
Download sequence
Identical sequences F6VVA0
ENSXETP00000036248 8364.ENSXETP00000036248 ENSXETP00000036248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]