SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000036914 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000036914
Domain Number 1 Region: 751-1001
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-46
Family YWTD domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 342-625
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.94e-30
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 
Domain Number 3 Region: 1553-1738
Classification Level Classification E-value
Superfamily Fibronectin type III 4.45e-28
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 1928-2096
Classification Level Classification E-value
Superfamily Fibronectin type III 1.21e-16
Family Fibronectin type III 0.0055
Further Details:      
 
Domain Number 5 Region: 87-323
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000000000693
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.01
Further Details:      
 
Domain Number 6 Region: 1411-1448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1315-1352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 1149-1186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000101
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 9 Region: 1189-1227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 10 Region: 1359-1396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 1068-1106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 12 Region: 1231-1264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 13 Region: 1463-1503
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 1109-1147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 15 Region: 1267-1304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 16 Region: 1508-1543
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000733
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000036914
Domain Number - Region: 1753-1920
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00015
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000036914   Gene: ENSXETG00000016937   Transcript: ENSXETT00000036914
Sequence length 2208
Comment pep:known scaffold:JGI_4.2:GL173450.1:119458:195728:-1 gene:ENSXETG00000016937 transcript:ENSXETT00000036914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQEGRRLRLLLFLTALVAASVEKAVGGRTLHGPSGWREPGARLTTVNAPYVGDRVTRR
PEQEPVVRRRRRSSGGTEHPVKVYGQVSLEDSHNQIVVHWAGEKSQVIVGLTRDSLALLG
PKSSNVYVSYDYGKSFKNISEKFTVPAGSANTATVSQFFHSPADNKRYIFIDANEQYLWI
SKDFCDTVNGFPAPFKPTDLLLHSTEPSLVLGYDKFHPNKQLWKSEDFGQTWTVIQEHVK
TYSWGIAPYDKINTIYVERHEPRGTSTVLRSTDFFQSRDKTEIIIEDVDDFQIRDKYMFA
TKTVHLQDSKKQPSVQLWVSYNRKAMRSAQFVTRHPITEYYIADASEDQVFVCVSHSNNI
TNLYISEAEGLRFSLSLENVLYFNPGGAGSDTLVRYFSNEPFADVHRVRGVRGVYIATIL
NGSFAEENMRSVITFDKGGTWEFLAAPVYNGYGEKVPCESSRGCSLHLAQRLSQLLNFQI
PIMPILSKESAPGLIVATGTVGTDMASKMNMYVSSTAGVRWRESLLGPHYYTWGDHGGIL
VAIAQGVDTNQLKYSTNEGETWKTFNFSDKAMIVYGLLTEPGEKSTVFTIFGSYTERGHS
WIILQINASDVLGVPCTDSDYKLWSPSDERGNECLLGRKTVFKRRTAHATCFNGEDFDRP
ITVSNCSCTREDFECDFGFKLSKDLSSELCVPDPEFAGKLYPIPIPCPVGTTYTRTKGYR
KVSGDTCSGGDVENRLQGEEVPCPVGEENEFILYAMRNSIYRYDLSSGINEELPLKGLHD
AVALDFDYQSNCLYWADVTLETIQRLCLNGSSGQEVIVRNGLETIESLAFDPLSQLLYWV
DAGMKKIEVASADGDLRLTILNSTVLERPRALALVPKEGLMFWTDWGDERHGIYRSEMDG
SSVKHLIFEGIKWPNGICVDEQWIYWTEAYMDRIERIDFNGQQRMIILDNLPHPYAIAVF
KNEIYWDDWSQLSIFRASKYNGARMEGIIGRLTGVMDMKIFYKDKATGHNACVLKPCSLL
CLPKANNSKICRCSEGVKGTPLSSGDIQCDCPQGYLLKNKTCVKQETENTCLPSQYRCSN
GNCINSIWQCDTDNDCGDMSDEKNCPTTTCDPEALFRCQGSGACIPLSYKCDLEDDCGDN
SDESHCEAHQCKEDEFNCSSGMCIRLSWVCDGDNDCRDWSDEANCTAISHTCEATSFQCH
DSHCIPQKWVCDGDTDCQDGSDEDHSICEKKCNGFQCQNGSCIPSVKHCDGVNDCPDGAD
EQQCEPLCTRYMDFVCRNRQQCLFHSMVCDGVKQCRDGSDEDPQYAGCSQGPEFQRTCDP
HSFLCQNGVCISLVWKCDGMDDCGDYSDEANCENPTDIPTCSRYYQFPCQNGHCIPTRWK
CDHENDCGDWSDEKDCGGSKAKTIPQTTSRPATCPSNHFRCDNGVCILNTWVCDGYKDCI
HGSDEEGCPASANKTVVPTILPHGQCSQFEFECKKWKDCIPSWRHCDGNRDCRDGTDELN
CPTHKPSLCVNGSLCEDGEACIALLDFCDGFLDCSDGSDENNCTDDTIVQKVQNLQWTAD
FTGNITLMWTRPKKMPQSSCVYNIYYRIVGESTWKSLETHSNKTVYVLKILKPDTTYQAK
VQVQCLRKAYNTNDIITLRTPEGVPDPPQHLQLSIMKDEFGNIFGSWTAPANAHGLIREY
IVEYSMSGVKEWTSLSVTSNNVLIKNLPRNTMYAVRVAAVTSRGVGDWSETKSITTVQGK
DIPVPTIKILSFNEDSITFNLKVDSEISVNYYFVSFVWEFDTRVQERRTLKFDGKTKDFK
VGNLTAQTSYEISAWITTIIGDSSVSFEHFVTQGLKPAAPSLKAKAINQTTIECNWSGVK
NVTYGIFYATSFLDLYRNPKNVTTTLHNATVIVNRDEQYLFLVRVISPYQGPPSDFAVVK
MIPDNRLPPRHLHVIQTDKTFADIKWESPYDSPDVKMAYAVAVKDLIRKTEISYKVNTQN
STIEYRIGNLEPGGKYSVTVQLRNMSKESTIKVSTVPLSAPEALKLISESDHILLFWKSL
ALKEKKFSEDRGYEIHMVDTTYNITTFLGNTTENFFKISNLKMGHNYTFIVQARCLYSGQ
ICGDPAVVLYDELVQGVDPLYSKSVQSTDVAAIVVPILFLLLVATGFGFVILYMRHRRLQ
NSFTAFANSHYSSRLGAAIFSSGDDIGNDDDDAPMITGFSDDVPMVIA
Download sequence
Identical sequences F6Y0W9
ENSXETP00000036914 ENSXETP00000036914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]