SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000037831 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000037831
Domain Number 1 Region: 60-569
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.18e-194
Family Myeloperoxidase-like 0.000000000000075
Further Details:      
 
Domain Number 2 Region: 20-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000629
Family EGF-type module 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000037831   Gene: ENSXETG00000017378   Transcript: ENSXETT00000037831
Sequence length 604
Comment pep:known scaffold:JGI_4.2:GL172705.1:1987293:1994685:-1 gene:ENSXETG00000017378 transcript:ENSXETT00000037831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVLPAAVFLSLLVFSQAANPCCSNPCQNRGVCMTVGHDRYECDCTRTGFYGENCTKPEF
LSWLRLKLKPAPNTVHYILTHFKGLWNIVNNISFLRDAIMRYVLTSRSHLIDSPPTYNSH
YGYKSWEAFSNLSYYTRTLPPVERDCPTPMGVKGMKELPSAKLVVEKFLMRRKFIPDPQG
SNVMFAFFAQHFTHQFFRTDMAKGAAFTKALGHGVDLNHIYGESLERQHKLRLMKGGKLK
YQMISGEMYPPTVKTTGVDMVYPPHIPDHLQFAVGQEVFGLVPGLMMYSTIWLREHNRVC
DILSNEHPEWDDERIFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQKFQY
QNRISAEFNTLYHWHPLLPDTFAISEKEYSYPQFLYNNSVMLNHGLTEMVESFSRQTAGR
VAGGRNFPAAITRVAVASIEHSREMRYQSLNEYRKRFMLKPFESFEELTGEKEMSAELEK
LYGDIDAMEFYPGLLVEQPRPGAIFGETMVEIGAPFSLKGLMGNPICSPEYWKPSTFGGS
VGFDIVNSASLQKLICNNVRDCPYTAFHVLKSKPSEKDFINASSDSTLENVKPSLILKEH
ASEL
Download sequence
Identical sequences Q501R2
ENSXETP00000037831 ENSXETP00000037831 gi|63100230|gb|AAH95912| gi|71895727|ref|NP_001025697| gi|89269018|gb|CAJ83938| 8364.ENSXETP00000037831 NP_001025697.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]