SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000037885 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000037885
Domain Number 1 Region: 4411-4625
Classification Level Classification E-value
Superfamily GFP-like 1.88e-58
Family Domain G2 of nidogen-1 0.0004
Further Details:      
 
Domain Number 2 Region: 4049-4147
Classification Level Classification E-value
Superfamily Immunoglobulin 6.64e-25
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 1619-1706
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-24
Family I set domains 0.0053
Further Details:      
 
Domain Number 4 Region: 3965-4054
Classification Level Classification E-value
Superfamily Immunoglobulin 4.43e-24
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 2453-2551
Classification Level Classification E-value
Superfamily Immunoglobulin 6.43e-24
Family I set domains 0.0052
Further Details:      
 
Domain Number 6 Region: 4313-4413
Classification Level Classification E-value
Superfamily Immunoglobulin 3.31e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 7 Region: 2944-3041
Classification Level Classification E-value
Superfamily Immunoglobulin 7.29e-23
Family I set domains 0.0069
Further Details:      
 
Domain Number 8 Region: 2360-2460
Classification Level Classification E-value
Superfamily Immunoglobulin 7.99e-23
Family I set domains 0.014
Further Details:      
 
Domain Number 9 Region: 2767-2851
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-22
Family I set domains 0.042
Further Details:      
 
Domain Number 10 Region: 1988-2087
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-22
Family I set domains 0.0028
Further Details:      
 
Domain Number 11 Region: 2559-2647
Classification Level Classification E-value
Superfamily Immunoglobulin 2.16e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 12 Region: 1702-1794
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 13 Region: 3606-3698
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 14 Region: 43-218
Classification Level Classification E-value
Superfamily vWA-like 5.68e-22
Family Integrin A (or I) domain 0.026
Further Details:      
 
Domain Number 15 Region: 3690-3784
Classification Level Classification E-value
Superfamily Immunoglobulin 9.42e-22
Family I set domains 0.017
Further Details:      
 
Domain Number 16 Region: 2860-2948
Classification Level Classification E-value
Superfamily Immunoglobulin 9.65e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 17 Region: 612-703
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-21
Family I set domains 0.0078
Further Details:      
 
Domain Number 18 Region: 2278-2367
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-21
Family I set domains 0.0065
Further Details:      
 
Domain Number 19 Region: 1419-1519
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-21
Family I set domains 0.023
Further Details:      
 
Domain Number 20 Region: 1895-1994
Classification Level Classification E-value
Superfamily Immunoglobulin 3.34e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 21 Region: 2660-2746
Classification Level Classification E-value
Superfamily Immunoglobulin 3.67e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 22 Region: 3224-3325
Classification Level Classification E-value
Superfamily Immunoglobulin 3.93e-21
Family I set domains 0.0068
Further Details:      
 
Domain Number 23 Region: 4240-4329
Classification Level Classification E-value
Superfamily Immunoglobulin 7.88e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 24 Region: 519-618
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-20
Family I set domains 0.024
Further Details:      
 
Domain Number 25 Region: 1223-1315
Classification Level Classification E-value
Superfamily Immunoglobulin 1.84e-20
Family I set domains 0.0073
Further Details:      
 
Domain Number 26 Region: 704-802
Classification Level Classification E-value
Superfamily Immunoglobulin 1.94e-20
Family I set domains 0.019
Further Details:      
 
Domain Number 27 Region: 3319-3418
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-20
Family I set domains 0.0074
Further Details:      
 
Domain Number 28 Region: 3868-3963
Classification Level Classification E-value
Superfamily Immunoglobulin 2.67e-20
Family I set domains 0.034
Further Details:      
 
Domain Number 29 Region: 1512-1610
Classification Level Classification E-value
Superfamily Immunoglobulin 6.08e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 30 Region: 1132-1220
Classification Level Classification E-value
Superfamily Immunoglobulin 8.71e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 31 Region: 1813-1901
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 32 Region: 905-998
Classification Level Classification E-value
Superfamily Immunoglobulin 1.46e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 33 Region: 2082-2177
Classification Level Classification E-value
Superfamily Immunoglobulin 3.25e-19
Family I set domains 0.0065
Further Details:      
 
Domain Number 34 Region: 3425-3512
Classification Level Classification E-value
Superfamily Immunoglobulin 3.93e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 35 Region: 4135-4231
Classification Level Classification E-value
Superfamily Immunoglobulin 7.62e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 36 Region: 985-1080
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 37 Region: 3149-3230
Classification Level Classification E-value
Superfamily Immunoglobulin 1.9e-18
Family I set domains 0.0054
Further Details:      
 
Domain Number 38 Region: 2171-2272
Classification Level Classification E-value
Superfamily Immunoglobulin 6.3e-18
Family I set domains 0.0092
Further Details:      
 
Domain Number 39 Region: 795-897
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 40 Region: 3049-3136
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-17
Family I set domains 0.0088
Further Details:      
 
Domain Number 41 Region: 1323-1425
Classification Level Classification E-value
Superfamily Immunoglobulin 4.49e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 42 Region: 3508-3601
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000155
Family I set domains 0.0098
Further Details:      
 
Domain Number 43 Region: 448-526
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000479
Family I set domains 0.047
Further Details:      
 
Domain Number 44 Region: 4886-4940
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000978
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 45 Region: 1092-1142
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000182
Family I set domains 0.079
Further Details:      
 
Domain Number 46 Region: 4684-4737
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000768
Family EGF-type module 0.012
Further Details:      
 
Domain Number 47 Region: 3828-3872
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000205
Family I set domains 0.072
Further Details:      
 
Domain Number 48 Region: 4723-4766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000037885
Domain Number - Region: 4764-4808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00218
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 4928-4971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00479
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000037885   Gene: ENSXETG00000017411   Transcript: ENSXETT00000037885
Sequence length 5092
Comment pep:known scaffold:JGI_4.2:GL172705.1:1652334:1775760:1 gene:ENSXETG00000017411 transcript:ENSXETT00000037885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPCRTLCLQYLLLLLLVQLLIQNSCGVAEPETPYIPDGASTLAFVFDVTGSMYDDLVQV
IEGASKILETSLNRPKKPLYNFALVPFHDPEIGPVTITTDPEKFQNELKELYVQGGGDCP
EMSVGAIKIALEISLPGSFVYVFTDARSKDYQLTNEVLQLIQQKQSQVVFVLTGDCDDRS
HHGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLISTDHSGGASHTWEIP
FDPSLKEVTVSLSGPSPGIELYDPSGKRMTPETGLNELLNIFNSAKVINMKEPVPGMWKI
KTSSNGRHSVRMTGVSTIDFRVGFSNKPTLDFSKTSSRPIQGIPTYVLLNTKGLSYPAKV
ERLELLTTSGSLLKTLPIKYYPDRTPYEIWNVTEFFPPNEAFFIKIIGYDKDDYLFQRVS
SVSFSNIIPGAPKVSMPKITPGYYLQSGSVPCFVESLIPVTVRFSKNGVKLGTDQKFRES
VNASWEIANVSVSDEGYYDCYASSSAGSARAQTFLDVNEPPPVIKAPSNITVTVGKGAIL
TCDVVSTVRFNLTWLRNNLDLKHMNPSKLSILRNNSLEIKSVTIDDGGEYNCFASNEGGT
ATASVTLIAQDPPKAVLEPRNVTFTKGAEIKLKCLVTGYPTPHIIWMHNDMFVRFSNRYI
ITHNGTFIIKNAVERDSGVYKCLATNAAGTDHQTSVMVYIEVPQVTAVKNEMLVPVGSET
TLACKATGIPRPLIHWYKGKKNIKLSPSALITIDSLLGTLKIKNTQFSDAGHYVCIAVND
AGKANGKVSLRVGSPPVFTQTPGDVSMDIGSDVSLTCSAEGIPEPKIKWRRLNHTSESSK
PLSYQYNSQQKAGTLQINSKSAIFLPELWVGDEGIYICEAENQFGKISSQATITVTGLVV
PVIGESPSVVSVIEGNQVTLPCVLLVGNPLPERHWVKDNVVLVTNPYTSIRADGSLHLER
VLLKDGGDYLCTAKNVAGTADRITTINVHVSPVIQHGPQIFSTIEGIAVSLPCKASGVPK
PTIIWKKKGEIVVPNNDTIIAESDGTLLLSSPGGEDSGEYSCSAINAAGYAARKVQLTVY
VTCLFHYICIKHSIFPSGSLKIFETRVSDAGMYTCVGTNIAGNITQLVKLSVYVPPKIQR
GPKLIRVKLGHSFEIACISHGIPPPTAAWYKDGQIMEFDQGQDNNMLRVESAKPSDGGTY
TCVASNVIGTDSANATVEIYDLEPPYNKQNQERISRQQISFPCPVKGHPKPVIKWFRNGK
ELTGSEPGVNIVEDRAVLVIDSLTPYDNGEYTCVASNEAGQTEKKYSLKVHDPPLIKDMD
IISNVSVLLHQTMSLLCEASGSPPPLITWYKGRTQTLIIICSFLGSIWVIGWHFIATVQI
LEKGKILKILKMALKDSGHYTCKANNIAGESKKQYFVNVLDPPTIAGVGTISDVSVIAGR
EVNLECKVKGIPFPSIQWFKENRLLSTEDPNVVMLENGQVLHIKHSRLSDSGKYKCIAAN
TAGSQTKEIKLTVYIAPTIKDGNSTTDLSFTVNGEINLECDARGIPPPTIIWYKDGEPLL
PSPYVTYIQKGKYLRITESQITDGGTYTCSVTNVAGQTEKNYSVDIYVPARIHGDEKKHQ
NKKVIVGKSLTLECEATGHPPPLITWLKDGVPVETNDNIRLHYNGKKLEIRNTVEYDRGL
YTCVAVNVAGETEMKYKVSVLVPPSIEGGNDPADHTVIASGAVELECLASGTPLPSVMWL
KNGTPVDTSGRLIIQSNGHKLLISSTESSDSGNYQCVVKNEAGSSTKQFNVVVHGELKLS
FLLSSTDDGWGCFRPTIKPVASPVSILMHKATTLQCIASGIPNPHITWLKDGLPFNVAKA
NILQFKKTLLEDAGKYTCVATNAAGEAEQTIWLNVYEPPKIENSGELIQETVLANHNIIL
ECKATGNPDPVVTWFKDNQQLTNTGDISVSDRGQVLQISGAQVFHAGTYKCVAASIAGRA
ELSYNLQVHVPPSISGRSSSITVIVNNVVRLECEATGFPAPSLTWLKDGSPVSSFTNGIQ
ILSGGRVLALTNAQVGDAGKYTCVAVNAAGEQQTDYDLSVYVPPNIMGEEQNISSLISET
LILKCESDAIPPPVLTWYKDWKPLVNRPGLTISEDGSILKIEGAQVKDTGRYSCEAVNIA
GKTEKNFNVNIMVPPAIRGSAEESEVNIIEGTLISLLCDSTGIPPPALAWKKNDVAIQSG
AAGHIRLLSGGRQLQIITARKSDAASYTCTASNSVGSAMKKYTVKVYVRPSISESGNHPS
EIVVIQGNNVTLECDARGDPQPMLTWLKEGIPLISGNGFEISSNGRLLHLQKAQISNAGL
YVCVAVNVAGQSDRKYDLKVFVPPAFPDGIMKHENISIVEKNPFTLTCEVSGIPPPKVTW
YKDGNPIPPSRSPQIMSGGFLLRFSQSSLSDTGRYTCAVSNAAGEDMRKFDVNVLVPPKI
TGSVQEEIKVKERGNITLSCEATGTPIPQITWLKDGHPVLEDTNHRIDHKGQLLRISNVM
MTDSGRYVCVASNPAGERSRSFSLGVLISPTIKGAINGSPEDVKVVLLSSISLECEVHSH
PPATITWHKDGRLFKFKDNVRILPGGRTLQILKAQEKDAGRYSCIATNEAGEGTHHYNLN
VHIPPKIRKDDISEFGGFSKEIKAIVNTNFTLVCDVKANPLAKITWYKDGQPLEPDSHLA
IVSGNTLYVEKAQVSDTGRYTCLASNIAGEDELDFDVTIQVPPNFPKLSGLWTTSKSSTG
SSNGEHKEVIINNPFSLYCETNAVPPPTITWYKDDKLLTPSNRAFILPGGHILQIARAQE
DDAGTYTCVAVNEAGRDSMHYNVRVLLPPAFEGSDEDLSKDITSLVNETLEMDCTVAVTG
SPAPTISWLKDGHPIQEGTRYHFLTNGRTLKILYAQLMDTGRYVCVVENPAGSVQKSFNL
NIYVPPSVIGSNSENVTVVESNFISLTCEVTGFPPPAVSWLKDTMVLNSDSHLFIVPGGR
TLQIPQTRLSDVGEYSCIAINQAGEAKKTFFLDIYAPPSIVANVRDSSTEVNVKVNASTI
LECESNAIPAPVINWYKNGQPIRETSSYQFLEGGQRLNIRNAQQVFDTGEYECIVTNVVG
QDNKKFFLNVYVHPSIQGLQNEYHNGIIQNSVTFSCDAYGIPVPTLRWLKDGHPIGLTDS
LEIQILSGGSKMKIARAQLTDGGTYTCLASNVEGTAEKTYILTIQVPPSIDGSGMTNELN
VLPGEIIQLICNAKGIPTPVIHWLKDGKHITSEDYLGINITSDGEILTISKTQTSDMGKY
TCVATNPAGEDDRIYNVNVFVAPKIDDNKGTPVVLTAVLDTSINVECHASGFPTPQINWL
KNGLPLPVSSQVRLQSGGQVLRISRVQKSDGATYTCIASNRAGVDKKDYNIQVYVSPSLD
EADVTQQITVIRDDPVVMRCIANGVPAPRISWLKDGKQLGDEYLPYIQSQGMVLHIVKAK
MDDIARYTCVASNAAGRVSKHFILNVMEPPHINGSEVTEELSVVVNTHLDLLCYTTGFPP
PLITWLKDGQPLSQNDNMHLMKAGQVLRITKNVGRFVCLASNHAGDTKKEFLVKVHIPPN
IAGVSGTQNITVLQKKQITMECKSDALPPPRITWLKDGQPLQPSPMVHILSNGQFVQIDN
TEVTDTGRYTCIATNIAGKTTKEFILNIQVPPSIEEGPSLVTAFVDEPVTLECISSGVPL
PKTAWRKDGSLLSHHNARFLVSQNGSLYISAVEVADSGQYFCLATNAAGSSQRQIDLLVY
AFPPVCPYNARGLQPETGNAGPFLIIWIFFFALKVVLMLSFYVCLPRLLSSGSLVIISPS
VDDTGIYVCSALSDAGDDEIDMYLSVHVPPTIADEAANIFVTKLSPAVIPCTVSGVPFPS
VHWLKDSIQLPAISDSYRILPSGSLEIPSSRLSHAGKYTCRAVNQVGSAHIHVNLHVQEV
PVIKEQNDYLEVVLSNSVTLACEASGTPIPTISWQKEGVGIKSGSSYTILSNGNLNIASA
TQEDAGTYTCIAQNPAGTALKKVRLKVHVPPRIVKNIKDVSVVINDQTTLPCAAHGIPTP
TITWAKNNLPITVKAGKYSVLASGELILYNAQHKDVGTYTCTASNAIGEDTHTVRLTVHF
PPSFTEMPTIVSLNEGERLSLLCKATGNPLPHTTWIFKDKILPVLQDRRSKQQNELVIDK
VSRENSGAYMCVAENIVASINTTIHVFVKEPPVLNGVHNKHRTVPLGGNIILNCVVKGNP
FPKIQWHKKAKVISYNKHIKEFSNGSLAIYDAGLEDVGDYTCIAANDAGVLEHTVTLTLQ
RPPTIKVPPLDTTVDAGATVALNCQSEGEPVPTITWYRHNNPISSEDRITILPNNSLQIV
SAQKEDTSVYECKATNIMGTDVVKVTFTVQGGPQRVKGNLFGRINDLDFGMAPLNATITD
DPNSGSRILQAKFTNIPKSLGPSMRNLVSLLNPIYWTTAKEIGEAVNGFSLTGGIFKRES
QVEFATGEILKITHTARGVESDGSLLLDTVVKGNVLQLQTSVDIHLKDYTEDYIQTGPGQ
VHAYSTRMFSVDGVYVPYTWNHTINYDVGQGTMPFLTETLQVNSIETDYNPQEESLSFQV
HASISRGDLSIQCPSGFSLDSTGLYCTDICEPTGVHSSYLLLNYSVAVPCWFAIQVPLKQ
CSPADIDECTLEDSICRKNQECKNTVGSYICGVKCGVGFRAAANDLVCQDINECLESNPC
HQRCLNSVGSYHCGCDTGYQLKGRRCIEDLNECRHGVCRQDQLCKNTRGSYKCIDVCPIG
LTRAENGTCVVSILATNGNHAGNLYSRQVSLPGFRFPSVCVPCTLHATHQSRVTQCIGAS
HNVLRAINRRERKWCPIPGPAAQLCTCTDINECEKGDVCQHECRNVLGSYKCLCPPGYQL
MANGKTCQDIDECLEQNIQCGMNRMCFNMRGSHQCIDTPCPPNYIRDTISGYCLKNCAPN
DLECALSPYALQYKLVSLPFGIAANQDLIRLVAYTEDGILHPRTTFLITDDYASLPFSIR
EENMKGVVFTNRPLQKPETYRMKVKALSYSIDRTIEYQTAFIVYIAVSPYPY
Download sequence
Identical sequences F6RHB6
ENSXETP00000037885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]