SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000037946 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000037946
Domain Number 1 Region: 553-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 385-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 342-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-18
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 497-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 5 Region: 594-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 441-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-16
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 7 Region: 665-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000147
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 713-762
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000268
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 315-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000032
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 10 Region: 83-129
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000209
Family KRAB domain (Kruppel-associated box) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000037946   Gene: ENSXETG00000017455   Transcript: ENSXETT00000037946
Sequence length 766
Comment pep:novel scaffold:JGI_4.2:GL178714.1:553:4405:1 gene:ENSXETG00000017455 transcript:ENSXETT00000037946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGVREKPPDTGRMMGKKDPLSDRILTLTLEIIRLLTGEDCVVMKKSAVGVLHAPGSALQK
ENSEKILELISNIIHLLTGEVAIRCEDVAVYFSMEEWEYIRENEALYTGESKENVQQRPP
LGCTNEASDEIKAAPEAELLPNNNPGLCTDGNITNTDISMHSAPTEPSPLYDERSQSDLS
ISELREQRQVMPAEGCSRNKDLPGNSTPSSIKEEYSPHGAEAHCDDRVEALTEQVGRPYT
PSPAMGCSLHNDTANSIKQETDSWDIESQSDCGRLPEYTINTSAYASHPGTDASPGKYTF
DGYQKPFIDTRNQNTEEKLYVCRECGKSFSHNYLLVRHQRNHSGEKPFSCLECGKSFTHN
YLLMRHQRYHTGERPFSCSECGKCFTQVSQLNYHQKSHTGEKPFTCSKCGKCFAYRSYLI
IHHRVHTGEKPFTCTECGKCFTHNYLLVRHRKNHSQEKAFACSDCGKSYTHPSQLANHQR
NHVRQKPYACTECGKCFSHNYLLLRHQKNHSGEKPFACSKCDRCFAQMSQLNYHLKGHTG
EKPFPCPKCGKRFAYRSQLLIHDRTHTGERPYKCMECGKCFTSRSHLNVHLQFHTGEKPF
PCTECGKRFTRRSHLSLHYRFHSGEGGYSCSICGKSFSLHSQLNEHLQLHAGAALFKCSE
CDIYFKSRLVLLEHYRFHTGEKMFYCSECDKCFPSRSQLIVHYRVHMGPNILACPECDEG
FERHSQLIEHLRTHTGDKPFSCSECGKCFGFQRNLNAHVRVHSDQE
Download sequence
Identical sequences F6Z3V8
ENSXETP00000037946 8364.ENSXETP00000037946 ENSXETP00000037946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]