SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000038482 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000038482
Domain Number 1 Region: 897-1026,1222-1410
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.12e-50
Family p120GAP domain-like 0.035
Further Details:      
 
Domain Number 2 Region: 496-585
Classification Level Classification E-value
Superfamily E set domains 1.52e-16
Family Other IPT/TIG domains 0.037
Further Details:      
 
Domain Number 3 Region: 584-689
Classification Level Classification E-value
Superfamily E set domains 0.00000000000007
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.082
Further Details:      
 
Domain Number 4 Region: 54-104
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000719
Family Plexin repeat 0.0014
Further Details:      
 
Domain Number 5 Region: 403-497
Classification Level Classification E-value
Superfamily E set domains 0.00000000000311
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 6 Region: 686-767
Classification Level Classification E-value
Superfamily E set domains 0.0000000602
Family E-set domains of sugar-utilizing enzymes 0.049
Further Details:      
 
Domain Number 7 Region: 25-58
Classification Level Classification E-value
Superfamily Sema domain 0.00000981
Family Sema domain 0.016
Further Details:      
 
Domain Number 8 Region: 354-387
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000471
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000038482   Gene: ENSXETG00000017724   Transcript: ENSXETT00000038482
Sequence length 1441
Comment pep:known scaffold:JGI_4.2:GL173009.1:5444:94649:1 gene:ENSXETG00000017724 transcript:ENSXETT00000038482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIRADGPPDGGIPYEVVNVTRDEIPLLRDMAFSTDNKYLYVMSERQVSRVEVEHCEQYSS
CEECLSSGDPHCGWCVLHNTCSRKDKCERAHEPFRFADNMKQCVKVDVQPNSLPVSEHSL
LLTLKVSNVPDLSAGVTCAFGDLKQEEGQVQSGSRIDCVSPAAKDIPTMLAAQDWFGVEL
QLISKETGKTFVSTNFKFYNCSAHQHCLSCVNGDFRCHWCKYRNLCTHDPTSCSFQEGRV
NVSEDCPQLVPSEEILIPVGEVRPITLKARNLPQPQSGQRGYECVLNIQGVVHRMPALRF
NSSSVQCQNSSYIYEGMDVSDLPVDFSVVWNGNFTIDNPQLIKVHLYKCAALRESCGLCL
KADHKYECGWCNGEGRCTLHHHCMSPQNQWLDWSSRNVKCINPRIHEILTVSGPPEGGTR
VTIRGANLGLNFSEIAQNVVVAGVQCTPVEEEYIIAEQIVCEMGQASPTSSSGPVLLCIE
ECKPEFMARSLQQYTFVSPTVAHLSPSRGPESGGTMITITGHNLAAGSIVSVTLGNQTCE
YYGRSLNEIVCVTAPSTHGLGPVHVSVSVDRAQLESNLQFEYIDDPKVLRIEPEWSIASH
SGHTSLTVIGTNLDIIQQPRIRVKSNGKESVNVCKVVNATCLTCLAPALTLEYRPGLDSV
ERPNEFGFIFNNVQSLLVFNNTKFIYYPNPTFELLSPNGVLEQKPGSPIILKGRNLCPPA
TGGAKLSYTVLIGKTPCAVTVSETQLLCESPNLTGQHKVTVYVGGMVFSPGSINVIPDSL
LTLPAIVSIAAGGSLLLIIVIIVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAF
AELQTDINELTSDLDRSGIPHLDYRTYAMRVLFPGIEDHPVLQELEVQGNRQQSVEKALK
LFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTALQGKLEYATDVLKQLLSDLI
EKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLHCAIKQQMEKGP
IDSITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKIL
DAVYKNVPYSQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRS
VVALVPKQTSSYNIPASASISRTSISRYDSTFRYTGSPDSLRSRAPMITPDLESGVKVWH
LVKNHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLAI
KYMFDFLDEQADRHGIYDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACLSV
VAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKNWVERYYADIAKLPAISDQDMNAYL
AEQSRMHAAEFNIMSALNEIYSYVSKYSVELITALEQDEQGRRHRLAYKVEQLIGAMSFD
S
Download sequence
Identical sequences F6X4N0
ENSXETP00000038482 ENSXETP00000038482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]