SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000039086 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000039086
Domain Number 1 Region: 12-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.63e-81
Family BAR domain 0.0000000178
Further Details:      
 
Domain Number 2 Region: 280-362
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-22
Family SH3-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000039086   Gene: ENSXETG00000015811   Transcript: ENSXETT00000039086
Sequence length 366
Comment pep:known scaffold:JGI_4.2:GL172715.1:2970564:2996959:-1 gene:ENSXETG00000015811 transcript:ENSXETT00000039086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDEFKEMEKKVDVTTKAVTDVLAKTIEYLQP
NPASRAKLSMLNTMSKIRGQVKNPGYPQPEGVLGETMIKFGKDLGDESNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFLDPLQNLCDKDLKEIQHHLKKLEGRRLDYDYKKKRQGKIPD
EELRQAMEKFIESKEVAETSMINLLDTDVEQVSQLTALVEAQLDYHRQAVQILDELSEKL
KDRVRESSSRTKREFKPKPRESYEYAESEQSNGGFSNPSSKAPASSSFRSEKPARTNNRS
SAPLDQPCCKALYDFDPENDGELGFRESDIITLTNQIDENWYEGMINGQSGFFPVNYVEI
LVPLPQ
Download sequence
Identical sequences Q6P836
ENSXETP00000039086 ENSXETP00000039086 8364.ENSXETP00000039086 NP_989126.1.99540 gi|113197648|gb|AAI21507| gi|38511937|gb|AAH61395| gi|45360901|ref|NP_989126|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]