SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000039559 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000039559
Domain Number 1 Region: 283-308,344-547
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-59
Family Voltage-gated potassium channels 0.00045
Further Details:      
 
Domain Number 2 Region: 154-250
Classification Level Classification E-value
Superfamily POZ domain 4.19e-27
Family Tetramerization domain of potassium channels 0.00000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000039559   Gene: ENSXETG00000018247   Transcript: ENSXETT00000039559
Sequence length 636
Comment pep:known scaffold:JGI_4.2:GL172945.1:1256176:1258242:-1 gene:ENSXETG00000018247 transcript:ENSXETT00000039559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAMVSADSSGCSSHLPYGYAQARARERERLAHSRAAAAAAAAGEGGNSGGGACQGAGR
APATQGNSGAGGNARRAPQSQEQQEEKEEEGTFPSELGPCGSEEMMLKEEVSEEEDQKFY
LCEDDEDEAGSLHRRRSPKEDGYHPVYSEFECCERVVINVSGLRFETQLKTLTQFPETLL
GDPEKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFSEEVKFYELG
EEALLKYREDEGFVKEEEKQLPENEFKKQVWLLFEYPESSGPARGIAIVSVLVILISIVI
FCLETLPEFRDDKDSLLSPLGMGDDGTGEDGEGGAYNATFLLTDHTAFNDPFFIVETVCI
VWFSFEFAVRLFACPSKPGFFKDIMNIIDIVSILPYFITLGTELGTGQQLPQGTGQQQQA
MSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVY
FAEADEPTTHFHSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVLTIALPVP
VIVSNFNYFYHRETDNEEQTQLTQSSSSCPYLPTNLLKKLRSSTSSSLQDKSEYLEMEEG
LKESLCIKDKASEGTGNGNETIKYNCVNLKILETDV
Download sequence
Identical sequences F6V7J2
ENSXETP00000039559 ENSXETP00000039559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]