SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000039840 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000039840
Domain Number 1 Region: 50-518
Classification Level Classification E-value
Superfamily Sema domain 1.7e-152
Family Sema domain 0.0000000516
Further Details:      
 
Domain Number 2 Region: 514-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000174
Family Plexin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000039840   Gene: ENSXETG00000018391   Transcript: ENSXETT00000039840
Sequence length 1076
Comment pep:known scaffold:JGI_4.2:GL172857.1:647440:688427:1 gene:ENSXETG00000018391 transcript:ENSXETT00000039840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRAGCAWALLLTVSTVCAVSFPEDDEPINVVDYHYSRQYPVFRGRPSGNDSQHSLDFQ
LMLKIRDTLYVAGRDQVYAINLNEVPKTEVTPSRRLTWRSGQADRKNCAMKGKHKDECHN
YIKVFVPRNDEMVFVCGTNAFNPMCRYYRLNTFDYDGEEISGLARCPFDARQTNVALFAD
GKLYSATMADFQASDAVIYRSMGDGFALRTIKYDSKWLKEPHFLHAIEYGNYIYFFFREI
AVEHNNLGKAVHSRVARICKNDLGGSQRVLEKHWTSFVKARLNCSVPGDSFFYFDVLQSI
TDIIEINGIPTVVGVFTTQLNSIPGSAVCAFTMDDIEKVFRGRFKEQKTPDSVWTAVPED
RVPKPRPGCCARHGYGEGYRSSTEFPDETLSFIKSHPLMDSAIPSIIEEPWFTKTRVRYR
LTAVAVDHLAGPYLNYTVMFVGSEAGVVLKILAKTNPFSLNDSVLLEEIDAYNRAKCSGN
SEEDRKVISLQMDRDHHALFVAFSGCIVRLPLSRCERYGSCKKSCIGARDPYCGWLNHES
CGRVKPGMFFGYEQDVEYGNTVQLGDCHDILPTATTPDYKIFGDPTSDIEVPSTSVTTTS
SPVILPKVIGSWKPRMTGSRKFIYQDDPNTSEYIDPLTGVQKGVRWEVQSGDANQMVHMN
VLITCVLAAFVLGAFIAGVIVYCYREMFVRKTRKIHKDAESAQSCTDSSGSFAKLNGLFD
SPVKEYHQSIDSPKHYTNILTSRKELPPNGETKSMMMDSQGQPPELAALPTPESTPVLHQ
KSLQPIKNQWEKTHNNLNISRKETPLKSPQFFPSSPPPHSPLAHGQIPSAVVIPNATHDY
NTSFSNSNAHKSDKKLHNLEHSLGKQSSKRDHRRSVDSRNTLNDFLKHLNESAGNPKALM
GDIQVPHQTLMLDTMGNMSEVPPKVPNREASLYSPSSTLPRNSPTKRVDVPSTPNGQMTP
IESQRSYHKNSSQRHSISAMPKNMNSPNGVLLSRQPSINRGGYMPPSPSTRMDYMQGTPI
IVHQQTSLSRQSSYTGHGTLPRMGVKRTPSIKPDVPPKPSFTSQNTSVRQLNKYSY
Download sequence
Identical sequences F7A6G7
ENSXETP00000039840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]