SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000040001 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000040001
Domain Number 1 Region: 866-1046
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0032
Further Details:      
 
Domain Number 2 Region: 1021-1142
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.14e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0047
Further Details:      
 
Domain Number 3 Region: 169-194,264-377
Classification Level Classification E-value
Superfamily PH domain-like 2.91e-28
Family Phosphotyrosine-binding domain (PTB) 0.0038
Further Details:      
 
Domain Number 4 Region: 17-158
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000383
Family Phosphotyrosine-binding domain (PTB) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000040001   Gene: ENSXETG00000018473   Transcript: ENSXETT00000040001
Sequence length 1241
Comment pep:known scaffold:JGI_4.2:GL173030.1:672432:764985:1 gene:ENSXETG00000018473 transcript:ENSXETT00000040001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVTCITPKSPGAKQAVLEFSLQLIGSLTVNSLTTMPMLPWVVAEIKKRNSKTVKNLQN
ALQIRLYVSSTSILCEPDPGKCQQWDPLICSSIFDCKPQLVQKLIHNSQDPSYFACLLRE
ENLASQESTCYLFHSADPLKVPEIIGSIRHAGKLARQEEVHSQLCDLDDSFSKKFEVLFC
GRVIVANKKAPPALIDECIDKFNHVSCTKKKEGDSPTPQGDSPPPQNKPIRKSYSQPGLR
TNTSFTNEWKDGRSSLPTSFEESDISLHVQRLCGEEQDSVQPTDMEENQTMLFTIGQAEV
YLVSPDTKRIVIEKSFKEISFCSQGIQHADHFGFICREPLLNGGCHFVCYVFQCANGALV
DEIMLTLKQAFSVAAVQQNSKTLPQLCDTCPMQCMHKLCERIEGLPPTKIKLELQKHITT
LSNQEQASMFEEIQKIRPRSEQQENELVISRLRCLYEEKQRDHIHNAETKQNSQAAESTA
NGLQTSASRFKLESLTSKAKRSLTESLENILSRGSRSRSLQESSASGDDDSSLCTPLDPS
IKELSLCETEPAAPLAIPLKTHGSLGDLSKSSDSYSCEHPEELVQQGFRRRANTLSHFPV
TAQEFPEPVQITPSVSQRKLIRHHSVSTETPHKRNTSSTPLPEPDHNPVQSAEPTAPRPV
SATSSPVTGKKLKVGSVGEAGAPLSQKSLFYRSTALRKKLHSSSSVPNFLKFLAPVAENS
TAGFNSSKSDFECKSIHSEAGCESPVRTRRHSWRQQIFLRVATPQKGCDSPNRYDDHSDL
GDIAPRSPLEPVSEDGPVRSAVAVRHRTTEELRELWKKAILQQILLLRMEKENQKLQASE
NDLQNKRLKLDYEEITPCLKDVTLVWEKMLSTPGRSKIKTDTEKIHAAVGQGVPRQHRGE
IWKFLSEQYQLRHQHISKNQLKDTPYKELLKQLTTQQHAILIDLGRTFPTHPYFSAQLGA
GQLSLYNILKAYSLLDPEVGYCQGLSFVAGVLLLHMTEEDAFKMLKFLMYDLGLRKQYRP
DMITLQIQMYQLSRLLHDYHRDLYNHLETYEIGPSLYAAPWFLTMFASQFPLGFVARVFD
MIFLQGSEVIFKVALSLLGSHKPLILQHENLESIVEFIKNTLPNLGLVQMEKTINQVFEM
DISKQLQAYEVEYHVLQDELIDSSPLSDNQRINKLEKANSTLRKQNFDLLEELQVSHGRI
QVLESTVENLQSNEVKLKRSVLTLELERSALLNTIEELRAQ
Download sequence
Identical sequences F6RVM6
ENSXETP00000040002 ENSXETP00000040001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]