SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000040366 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000040366
Domain Number 1 Region: 1003-1129,1343-1532
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.69e-51
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 2 Region: 2-159
Classification Level Classification E-value
Superfamily Sema domain 1.24e-36
Family Sema domain 0.0075
Further Details:      
 
Domain Number 3 Region: 692-796
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000345
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.037
Further Details:      
 
Domain Number 4 Region: 508-606
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000215
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 5 Region: 605-694
Classification Level Classification E-value
Superfamily E set domains 0.000000000000102
Family Other IPT/TIG domains 0.021
Further Details:      
 
Domain Number 6 Region: 162-214
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000615
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 812-884
Classification Level Classification E-value
Superfamily E set domains 0.000000784
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 462-496
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000144
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000040366   Gene: ENSXETG00000018635   Transcript: ENSXETT00000040366
Sequence length 1562
Comment pep:known scaffold:JGI_4.2:GL172984.1:653387:840353:-1 gene:ENSXETG00000018635 transcript:ENSXETT00000040366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KESVMCLFTLKKIKDKIKERIQSCYRGDGKLSLPWLLNKELGCINSPLQIDDNFCGQDFN
QPLGGTVTIEGTPLFLDKEDGMTSVAAYDYRGHTVVFAGTRSGRMKKILVDLSASSHMAQ
QYENVVVHEGNAILRDLVLSPDRQYIYAMTEKQVTRVPVESCEQYETCDACLGSRDPHCG
WCVLHNMCSRKDKCERADELHRFTSDQRQCVQLTVHPRNISVTVSEVPMVLQAWNVPDLS
AGVNCSFEDFTEMEGRILDGKIYCTSPSTKDVIPITRGHGKERWVLKLYLKSKETGKKFA
SVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNAADCSFQEGRVNMSEDCPQILPS
TQIYIPVGVVKPITLTAKNLPQPQSGQRNYECIFHIPGSVTRVTALRFNSTSIQCQNTSV
SVSGDGCLQLPVNLTKSLLVHILLTTVFSPAAHLYKCSALRESCGLCLKSDRRFECGWCV
SEKKCTLRQNCPAYENPWMHASTVNSRCTDPKITKLFPETGPKQGGTLLTITGENLGLRF
EDIRFGVRVGHVMCVPIENEYISAEQIVCEIKDAGKMRVHEAQVEVCVKDCSQDYRAISP
KSFTFVVPSFNRVTPSRGPLSGGTWISIEGSYLNSGSDVSVDIGGRPCMFSWRTAKEIRC
KTPQGPSTGKAEIQIHINRATLYNSEVHYNYTEDPTVQKIEPEWSIASGGTPLIVTGLNL
ATIKEPKIRAKYGDAERENNCTVYNDTTMVCLAPSVENPLRSPPENGDRPDEIGFIMDNV
LALLIVNTTSFLYYPDPVFEPLTASGNLELKPSSPLIIKGRNLIPAAPGNFRLNYTVLIG
DTPCALTVSETQLLCESPNLTGQHKVTIKAGGFEYSPGTLQIYSDSLLTLPAIIGIGGGG
GLLLLIIIIVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTND
LDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIR
TLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRT
ESVAEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKL
IRQQIDYKTLNPCADDVGLSDESCCRSPQTLNCVNPENENAPEIPVKVLNCDTITQVKEK
LLDAVYKGVPYSQRPKAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTD
GSSVALVPKQNSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLW
HLVKNHDHLDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLA
IKYMFDFLDEQADKHQITDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLS
VVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKSWVERYYADIAKMSVISDQDMSAY
LAEQSRLHLSQFNSMSALHEIYSYITKYRDEILTALEKDEQARRQRLRSKLEQVIDTMAQ
SS
Download sequence
Identical sequences F7BA34
ENSXETP00000040366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]