SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000040545 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000040545
Domain Number 1 Region: 63-518
Classification Level Classification E-value
Superfamily Sema domain 1.96e-155
Family Sema domain 0.0000000782
Further Details:      
 
Domain Number 2 Region: 514-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000767
Family Plexin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000040545   Gene: ENSXETG00000018720   Transcript: ENSXETT00000040545
Sequence length 1029
Comment pep:known scaffold:JGI_4.2:GL172643.1:5187528:5245666:1 gene:ENSXETG00000018720 transcript:ENSXETT00000040545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEGLLLYFTILQFARAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNSTQRHKMDIQQ
IVIMNRTLYIAARDHIYTVDLETSYTEEIFFSKKLTWKSKQSDVDTCRMKGKHKDECHNF
IKVLLKRDEDTLFVCGTNAFNPSCRYYKMDTLEFLDEEISGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGDGPTLRTVKYDSKWLKEPYFVHAVDYGDLIYFFYREIA
VEYNSMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIHINGRDVVLATFSTPYNSIPGSAVCAYDMADIASVFTGRFKEQKSPDSTWTPVPDER
VPKPRPGCCAGSATVERITKSNELPDDTLNFIKTHPLMDEAVPSVINRPLFLRTMVRYRL
TKIAVDTAAGPYQNHTVVFLGSERGIVLKFLARTGYSGFLSDSLFLEEMNVYNSEKCSFD
GAEDKRILGMQLDKHNNALYVAFSTCVVSVPLARCDRHTKCKKTCIASRDPYCVWLREGG
TCSQLLTGTKLPFEQDVEHGNTDGLGDCQNSFVALNGKKMDLFPSQYPSTTSYSRVHEGY
DRGSMLDWKDIYDSSENTDPHVADSFHNHQDKKGVIRESYLKGHDQLVPVTLLAIAVILA
FVMGAVFSGIIVYCICDHRRRDVDVVQRKDKDLSRSRRGSMASVTKLSGLFGDSQSKESK
PEAILTPLMHNGKLATPSTTAKMLIKAEQHHLDLAALPTPESTPTLQQKRKPSRGSRDWE
RNQNIINACTKDMSAMVSPVIPTDLPLHASPSHIPSVVVLPITQQGYQHEYVDQPKLTEV
AQISIENQSSTLEYKTIKEHLASKSPNHGVNLVENLDSIPPKVPQREASLGPPSSSVSQN
GMGKRIDLHSSAYSVDYKRNYPTNSLTRTHQTSTLKRNNTNSSNSSHLSRHQSFGRGDNP
PPAPQRVDSIHFSAAQGQAVTLTRQPSINAYNSLPRSGVKRTPSIKPDVPPKPTFSPLSS
SITSNDACT
Download sequence
Identical sequences F6UUL1
ENSXETP00000040545 ENSXETP00000040545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]