SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000044646 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000044646
Domain Number 1 Region: 248-519
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-83
Family Protein kinases, catalytic subunit 0.000000000683
Further Details:      
 
Domain Number 2 Region: 137-281
Classification Level Classification E-value
Superfamily SH2 domain 1.03e-39
Family SH2 domain 0.00000782
Further Details:      
 
Domain Number 3 Region: 73-147
Classification Level Classification E-value
Superfamily SH3-domain 1.74e-24
Family SH3-domain 0.0000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000044646   Gene: ENSXETG00000020659   Transcript: ENSXETT00000044646
Sequence length 527
Comment pep:known scaffold:JGI_4.2:GL172742.1:2407894:2433897:-1 gene:ENSXETG00000020659 transcript:ENSXETT00000044646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCKQCKEDKVEKVEENALEIPQRYCPDPTSQMPFRIQETHTPFISAGIGGVIAGSSQRG
MGVGVTETKGGPRKGGVTQFIALYDYDARTEDDLTFKKGEKFHIINNSEGDWWEARSLSS
GNTGYIPSNYVAPMNSIQSKDWYFGKIGRKDAERLLLCEGNPRGTFMIRESETTKGAYSL
SVRDWDATRGDHAKHYKIRKLDNGGFYITTRVQFDTVEELVEHYSEFNDGLCHLLTNPCI
NQKPQTLGLSKDAWEITRDSISLDKKLGQGCFGDVWKGTWNGTTNVAVKTLKPSTMSPEA
FLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEFMTKGSLLDYLKEGEGHLLKLPQLVDM
SGQIASGMAYIERMNYIHRDLRAANILVGDNLICKIADFGLARLIEDNEYTARQGAKFPI
KWTAPEAALYGKFTIKSDVWSFGIMVCELVTKGRIPYPGMSNREVLEQVERGYRMPAPPA
CPPSLHELMLQCWRGDPEERPTFEYLQSFLEDYFTATEPQYQPGDNI
Download sequence
Identical sequences F7E859
ENSXETP00000044646 ENSXETP00000044646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]