SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000046165 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000046165
Domain Number 1 Region: 258-525
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-82
Family Protein kinases, catalytic subunit 0.000000000615
Further Details:      
 
Domain Number 2 Region: 119-245
Classification Level Classification E-value
Superfamily SH2 domain 6.79e-38
Family SH2 domain 0.00000301
Further Details:      
 
Domain Number 3 Region: 57-150
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-22
Family SH3-domain 0.0000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000046165   Gene: ENSXETG00000021344   Transcript: ENSXETT00000046165
Sequence length 534
Comment pep:known scaffold:JGI_4.2:GL172886.1:647866:698453:-1 gene:ENSXETG00000021344 transcript:ENSXETT00000046165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEATKLTDERDNSLTQSLGYRYGTDPTPQHYPSFTVTTIPNYNNFHTNAGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFQKGEKFQILNSSEGDWW
EARSLTTGGTGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTYLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSEKADGLCF
NLTLIAPNYTPQTVGLAKDAWEVARNTISLEQKLGQGCFAEVWFGTWNGNTKVAIKTLKP
GTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALK
LPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTAR
QGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGY
RMPCPQDCPNSLHELMLNCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences F6S8L5
ENSXETP00000046165 gi|301615025|gb|XP_002936976| ENSXETP00000046165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]