SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000046997 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000046997
Domain Number 1 Region: 86-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-28
Family Clostridium neurotoxins, the second last domain 0.022
Further Details:      
 
Domain Number 2 Region: 492-588,624-642
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000000567
Family Reprolysin-like 0.05
Further Details:      
 
Domain Number 3 Region: 356-481,545-611
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000234
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 4 Region: 1279-1345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000195
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 5 Region: 1410-1483
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000501
Family Complement control module/SCR domain 0.0074
Further Details:      
 
Domain Number 6 Region: 1341-1415
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000417
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 7 Region: 1211-1283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000354
Family Complement control module/SCR domain 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000046997
Domain Number - Region: 879-940
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000128
Family Fibronectin type III 0.0075
Further Details:      
 
Domain Number - Region: 1557-1587
Classification Level Classification E-value
Superfamily Notch domain 0.0275
Family Notch domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000046997   Gene: ENSXETG00000021730   Transcript: ENSXETT00000046997
Sequence length 1631
Comment pep:known scaffold:JGI_4.2:GL172772.1:1186550:1334678:1 gene:ENSXETG00000021730 transcript:ENSXETT00000046997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWSLLLPLGLLCAALASASQCGMDERSQRPRRNVRNPRSLRRGSEGSCATSLARGRRS
LPSIEHLRIPQRRKQREAKESSNVPAPGKALYFTGHGDQLRLKSGNELPRDTFTLQVWLR
AEGGQKSPAVIAGLYDKCSYTSHDRGWVLGIEALSDQGTRDPRYFFTLRTDRARKATTIT
AHRSYLPNQWVHLAVTYNGRIIKLYVNGAQAATSNEQVGPIFSPLTQKCKVLMIGGNAQN
QNYRGYLEQFTLWKTPRTQEKIVHDMGQAIHGLSTSLPQLVLQDSFENVKHAWSPMKEGK
FPQIENIYHHGSSLDTILDLPQCGQTLCDNLEVITNYNKFTSFRQPKVVRYRVVNVYDDN
HENPTVTKDQIELQHRKLNEAFSKYNITWELDLLEKNDSFLRHRLILTNCDITKIGDGFC
EPECNHALTGFDGGDCRRTIPSVALRKKQNGVCDMDCNIESFHFDGGDCCNPNVTDVTKT
CFDPESPNRAYLDVNEMKNRLNLTGSTQLNIFFANSSEELAGVATWPWDKEVLTHLGGIV
MNPSFYGVPGHTHTMIHEIGHSLGLYHVFRGISEIQSCSDPCMETDPSFETGDLCRDTNP
APKHKMCGDPGPASGNDTCGFQKFVNTPFNNYMSYADDDCTDSFTPNQVARMHCYLDLVY
QSWQPTLKPLPVAIAPQIVERTPASVTLEWFPPIDGLFYEREVGTACHLCADQRVLVQYA
ANASSPVPCNPSGHWSPREAEGHPDVEQPCETSVRTWSPNSGGNHHNVPPTCPEPHGCHL
QLEFSHAVVPQSLTIWVTFVNTEWDTSGAVVDVKLLMVNGKELSLGPQNIFCDVPLTIKL
DNKDINEEVFGIQIYTKDNLMEIDAAMITSVPNSPLCAGCMPVHYKVLRDPPVEGEVPSL
ISNLHRRYTDTNLKLNSIYKYQVVTMSGNKESEPSPELVYQHGSGYCGDGIIQEDLGEEC
DDMNKLNGDGCSFFCRQEVSFNCLDEPSRCYFHDGDGVCEEFERMTSIKDCGVYTPKGFL
DQWASNVSVSHQSEQLCPGWVVIGQPAATQVCLTKVLDLNDALSQYAWYPCTVTTHFVNF
WLKAYFSRPVVVAAVIVHLVTDGTYINDQKPETISVQLIDTKEQLHDLGVHILSCRNNPL
VISVMHDLSRPFYHSQTVLVSFTSNFVAISGVALRSFHDFDPVTISSCQRGEIYSAVEQS
CVHYSCEATDCQELEIENSDVKCTSGHYNGAQCEVTCHTGYILQIHRDDDLLKTQFESHI
ILTCRDGKWTKQVTCEPVDCGFPDKTHIHPATFSCPQGTTYGKQCTFQCRPPAQLRGTNN
MLTCLEDGLWSFPESICELMCLAPPSLPNAILQTARCLDDGHKVGSFCKYRCKQGFHVND
PLKKTKKGRKAFKTQCMEDGSWQLGKCVPITCEPPHPKFRGLYQCTNGFQFNSECKLMCE
ESNSQSDKVNNVIQCRKDGTWSGSFHLCQNIQGQCPPPYHMNNSMKIHCSEGYNIGKGAE
CMPICLNHNVEDNKMEAVILPANMTEKNLPHWMSPLRVKKIICTAGLQWYPLPGELYCIK
SCEPFMGDNYCDGMNNRAFCNYDGGDCCVSTVKTKMVTPFPANCDLQGECACLDPKAQEN
IHKDAHHPSLG
Download sequence
Identical sequences F7C2R5
ENSXETP00000046997 ENSXETP00000046997 8364.ENSXETP00000046997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]