SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000047307 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000047307
Domain Number 1 Region: 199-471
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.7e-79
Family Mitochondrial carrier 0.0000576
Further Details:      
 
Domain Number 2 Region: 13-174
Classification Level Classification E-value
Superfamily EF-hand 1.36e-33
Family Calmodulin-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000047307   Gene: ENSXETG00000024509   Transcript: ENSXETT00000047307
Sequence length 481
Comment pep:known scaffold:JGI_4.2:GL173333.1:409221:417032:1 gene:ENSXETG00000024509 transcript:ENSXETT00000047307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAPGGHMALTPAAAMHGPDSLDPDREKRYALLFSQLDSNRDGRVDINELREGLQALGMTP
CHNAEQEILRAGDTDQDGQLDFEEFTHYLEERERRLLIMFNSLDRNNEGQIDISEIQECF
HGLGIHITLAQAKKVLQSMDRDGTLTIDWLEWRDHFLLNPLHNMEDVITYWKHSSMLDIG
ESLAVPDEFSKKEIRSGMWWKQLLAGGVAGAVSRTGTAPLDRLKVLMQVHGSQGLSILRG
LRVMIEEGGVRSLWRGNGINVIKIAPESAIKFMAYEQIKKLIRGQHETLRVRERFIAGSL
AGAIAQTAIYPMEVLKTRMALRRTGQYSGMSDCARQILRNEGVRAFFKGYIPNLLGIVPY
AGIDLAVYETLKNTWLQRYRSSTSADPGVLVLLACGTVSSTCGQIASYPLALVRTRMQAQ
ASVQGSPQLSMVALFRHIVAREGFLGLYRGIAPNFMKVIPAVSISYVVYENMKRLLGVTS
R
Download sequence
Identical sequences F7AFJ9
ENSXETP00000047307 ENSXETP00000047307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]