SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000047775 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000047775
Domain Number 1 Region: 54-516
Classification Level Classification E-value
Superfamily Sema domain 4.97e-145
Family Sema domain 0.000000167
Further Details:      
 
Domain Number 2 Region: 512-545
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000133
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000047775   Gene: ENSXETG00000022081   Transcript: ENSXETT00000047775
Sequence length 548
Comment pep:known scaffold:JGI_4.2:GL173572.1:4100:19498:-1 gene:ENSXETG00000022081 transcript:ENSXETT00000047775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCACLVLMGGLGESVFPEEAVPISKAGVEYLQTYPVFLGKGPSKTAERERDRLNIQKILM
VNRTLYVGDRDALYQIMLDSYSTELQYHKKLIWKSNHQDINVCRMKGKQEDECRNFVKVL
LLKDYQTLFICGTNAFNPVCADYSIDTLEQVGDTLSGMARCPYDPKHANVALFADGMLFT
ATVTDFLAIDAVLYRSLGPRLALRSVKHDSKWFKDPYFVHAVEWKEHVYFFFREVAMEFN
YLEKVVVSRVARVCKNDMGGSQRVLEKQFSSFLKARLNCSVPGDSHFYFNVIQTVSNILN
IGGRQVVLALFSTPTNSIPGSAVCVFDMEQVASVFSGRFREQRSPDSVWTPVPEELVPRP
RPGCCVGHSHPYNSSRSLPDEVLNFVKSHPLMEDSVPSIGGFPWITRTLTRNQLTHLAVD
ASSGVHGNHTVLFLASDSGTVLKYLLIPKMSGSEIGTLANQTVLLEELQTYPANRCGWDE
EDQKILGIEVDKGSGSLLLAYSSCIVKVPLARCQRHDGCIRSCLGTRDPYCAWDPANNLC
TFTPQGIR
Download sequence
Identical sequences F6Q6S9
ENSXETP00000047775 ENSXETP00000047775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]