SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000048152 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000048152
Domain Number 1 Region: 23-463
Classification Level Classification E-value
Superfamily Sema domain 2.88e-109
Family Sema domain 0.000078
Further Details:      
 
Domain Number 2 Region: 1310-1435,1612-1798
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-49
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 797-890
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000369
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 887-976
Classification Level Classification E-value
Superfamily E set domains 0.00000000000369
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 5 Region: 466-516
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000196
Family Plexin repeat 0.002
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000048152
Domain Number - Region: 761-793
Classification Level Classification E-value
Superfamily Plexin repeat 0.000162
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number - Region: 1458-1552
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0508
Family Ubiquitin-related 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000048152   Gene: ENSXETG00000022253   Transcript: ENSXETT00000048152
Sequence length 1831
Comment pep:known scaffold:JGI_4.2:GL172656.1:903824:945705:1 gene:ENSXETG00000022253 transcript:ENSXETT00000048152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALWFQVSSLIICIILMPQAQTFLSFFSDTDLNHLAVNNDTGIVYIGAVNRLYQLSAELD
MQVNFTTGPKLDKKSCTPPIDSQQCPSAEITDNYNKLLLLDKPHERIIVCGSIFKGICSL
RAMSDISTELWYKDNLGEKSFVASNDEVISTVGLVTNHGKEKRRLLFVGKGHVQNDNGII
ISTRILEKKEDRDVFEVYQDSATFKSVDHIKHFQQFVTAFENDDYVYFVSTRADRISNEN
RTFISRLCKDDFNYYSYIEMPLECKNQRNNESKPGSDLADIMKLPSTETTVLFGVFSRKQ
VSDQSAVCVFSLSEINNKFEENREACYTSNKADLKTLFFKPYGGELSCANSPSGAAKSYR
CGSEHLPYPLECKEGVSKSSVLIREKNPFSSVAIAVENEHTIAFLGTAEGKLVKVIIMPK
DQSYEYRNLSFETSSAVKNGMVFDADQKHLYVMTKKKAYRVPVQDCARSSNCNECISTND
PYCGWCVLEGKCTRKVDCPRNNNSHWLFSPSGTCMQVKSATPGNMSVMSLRKVTLTVEPS
IYLLYDDNLICDFGGAKTTAELQQDGTISCQPPNRIPSPEKGKDNVNITINLSFQKNGDV
FFANYSYPFYNCKEAINLSENMPCTSCVTSRWNCQWDINNHRCEDSSQRDDVIEPNMEEN
CPQFYEPNPSLIPMKHKSTITFNGKNLDHYKNEDFSAGSDEFTFKTDVLQIDGSFSLSIP
EVLQFPAEDKETVPLGIYIKVNEKKIDSKLNVNLYNCMYGRSDCSLCLAADPVYQCVWCN
DKCVYKDMCEESPATECPAPKITDLVPIAAPLKGGIRLTIKGSNLGIKPADVEEIIVANT
PCTFIEELYSVSTSVVCEVGAVDEPDSGNVKIKIKEKMGISSQIFTYQDPNPDSLHPLEG
IMAGGTRLTIKGQRLETGSENDIRVTLDSIPCAVKSFGEEIVCDTGMASKKGEVAVKLLY
GDCTEINAGHFIYKENPSIAHFTPDRSFARLTNSLLITLKRAVINQAFSSICSLIPNLHE
KWLSPVTKLIILQISQEDILEKVNDSVIIFTSPQVPENYLTSGVTIVIKMDGLESPLQTN
ELSFLYIPDPTFENFTDGIKKQVNNLINAKGDNLNAAMTIEEAKAFVGEGTCKINTLTST
DLYCVPPEEQPPPKRRHKRDTANNLPEFIVKFGKREWVLGKVEYGQSPAIPLHIIIPVVI
IPMLLIIGIAVYFYRRKSQQAEREYEKVKLQLEGLEETVRERCKREFTELMIEMEDQTSD
LSEAGIPFLDYKTYTDRVFFLSSKDGEKDVMITGKLDIPEARRQTVEVALNQFSNLLNSK
SFLTIFIHTLESQKDFSAREKLYLASLLTVALHGKLEYYTDIMRALLMELMDQYVAKNPK
LLLRRSETVVERMLSNWMSICLYQYLKDTVGEPLYKLFKAIKHQVEKGPVDALQAKAKYT
LNDTGLLGDDVEYKQLTVNVIVQEEGAEPVPVKVLNCDTITQVKEKIVDQVYRNIPYSLR
PKADSLALEWRPGSTAQILSDLDLTSQKEGRLKRYNTLMHYNVRDNATLILSRMGISQQQ
EENHQDFPGERNALLEDENKAWHLVRPADEVDEVKSKRGSMKEKERTKAITEIYLTRLLS
VKGTLQQFVDNFFQSVLNSNQVVPPAVKYFFDFLDEQAEKYEIKDEDTVHIWKTNSLSLR
FWVNILKNPHFIFDVHVHQVVDASLSVIAQTFMDACSRTEHKLSRESPSNKLLYAKEIST
YKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTESLNTLVALHQLYQYTNKYYDEIIN
ALEEDPAAQRMQLAYRLQQIAAALENKVTDL
Download sequence
Identical sequences F7A555
ENSXETP00000048152 ENSXETP00000048152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]