SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000048743 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000048743
Domain Number 1 Region: 137-379
Classification Level Classification E-value
Superfamily vWA-like 2.11e-84
Family Integrin A (or I) domain 0.000000231
Further Details:      
 
Domain Number 2 Region: 638-726
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.88e-22
Family Integrin beta tail domain 0.0007
Further Details:      
 
Domain Number 3 Region: 372-468
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-21
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 4 Region: 27-84
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000012
Family Plexin repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000257
Family Integrin beta EGF-like domains 0.0035
Further Details:      
 
Domain Number 6 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family Integrin beta EGF-like domains 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000048743
Domain Number - Region: 519-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0614
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000048743   Gene: ENSXETG00000026716   Transcript: ENSXETT00000048743
Sequence length 798
Comment pep:known scaffold:JGI_4.2:GL173139.1:444179:466239:1 gene:ENSXETG00000026716 transcript:ENSXETT00000048743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARYSVLTFGLLTCLALCINAQQGGTECLKANAKSCGECIQAGPNCGWCTKVNFLQEGEP
TSARCDDLAALKNKGCPEEDIQNPRGRKQKLKDIPITNKGKGERMDPANITQIRPQQLVF
ELRSGEPQTFNLTFRRAEDYPIDLYYLMDLSFSMKDDLENVKSLGTALMTEMEKITSDFR
IGFGSFVEKTVMPYISTTPAKLINPCTSDQNCTSPFSYKNVLNLTSDGKLFNDLVGKQQI
SGNLDSPEGGFDAIMQVAVCGEQIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKC
HLHGNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEDFQPVYQELKNLIPKSAVGTLS
SNSSNVIQLIIDSYNSLSSELILENSKLPEGVTISYKSFCKNGVKGTGEDGRKCSNISIG
DQVEFEISVTAHKCPKKGQAESIKIKPLGFTEEVEIVLQFICECDCQEKGTPNSPECHHG
NGTFECGACRCNEGRIGKECECSTDEVNSEDMDAYCRRENSSEICSNNGDCICGQCVCKK
RDNPNEVYSGKYCECDNFNCDRSNGLICGGKGVCKCRVCECFPNYSGSACDCSEDTSTCM
AKNGQICNGRGICDCGRCKCTDPKFQGPTCELCQTCVGVCTEHKECVQCRAFQKGEKQEV
CLEQCMHFNISLVESREDLPQPGQAEALTHCKEKDAEDCWFYFTYSVDSKNEVLVHVVKE
PECPSGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences Q6P4X1
gi|38649395|gb|AAH63214| gi|45361049|ref|NP_989160| NP_989160.1.99540 ENSXETP00000048743 ENSXETP00000048743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]