SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000051270 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000051270
Domain Number 1 Region: 180-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.07e-57
Family Voltage-gated potassium channels 0.0009
Further Details:      
 
Domain Number 2 Region: 39-143
Classification Level Classification E-value
Superfamily POZ domain 2.94e-32
Family Tetramerization domain of potassium channels 0.00000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000051270   Gene: ENSXETG00000023771   Transcript: ENSXETT00000051270
Sequence length 632
Comment pep:known scaffold:JGI_4.2:GL174634.1:12107:22001:-1 gene:ENSXETG00000023771 transcript:ENSXETT00000051270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVATWLPFARAAAVGWLPLAKRPMPKPPSDKRMKSDEILVVNVSGRKFQTWKNTLDR
YPDTLLGSTEKDFFFNQDTQEYFFDRDPEMFRHILNFYRTGKLHYPRHECIQAFDEELSF
YGIIPEIIGDCCLEEYRDRKKENLERLAEDTEAETAGDTPLPPDSTFRQRLWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCRPPAGRLKELPCGEKYNLAFVCMDTACVLIF
TFEYLMRLFAAPSRCKFMRSVMSIIDVVAIMPFYIGLVMPENENVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTSKTKFTSIPAA
FWYTIVTMTTLGYGDMVPDTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KRRAQQKIRLARIRLAKSNTTGAFLRYKESGGLEEGTESHALCVKNRSAFELQHHHLLHC
LEKTTCHEFTDQHTYSEALMTESIGYRTSRSTSVSSQQGFGTSCCPRRNKRRAIRLANST
VSVSRGSMQELETLHVHKGLSQRYRSSLNAKTHGNMKLNCETSDLTAAIISIPTPPANSP
DESQPSSPSSGVLRNSSITARYYQETVRISSL
Download sequence
Identical sequences F7CVI3
ENSXETP00000051270 ENSXETP00000051270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]