SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000052037 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000052037
Domain Number 1 Region: 489-743
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-49
Family YWTD domain 0.00000781
Further Details:      
 
Domain Number 2 Region: 47-291
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-33
Family YWTD domain 0.00014
Further Details:      
 
Domain Number 3 Region: 316-445
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000596
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 4 Region: 930-973
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000145
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 5 Region: 884-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000298
Family EGF-type module 0.02
Further Details:      
 
Domain Number 6 Region: 842-895
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family EGF-type module 0.037
Further Details:      
 
Domain Number 7 Region: 447-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000088
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000052037
Domain Number - Region: 807-855
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00046
Family EGF-like domain of nidogen-1 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000052037   Gene: ENSXETG00000013368   Transcript: ENSXETT00000052037
Sequence length 1053
Comment pep:known scaffold:JGI_4.2:GL172725.1:626701:689109:-1 gene:ENSXETG00000013368 transcript:ENSXETT00000052037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFLLTALWPLVFDVLLLHTQGNKQWHCTGNPLPLDNERYACNTPVPFLIFSHGNDIFTI
NSDGTNLRKVVPSAGSTLQIDFIQQENRLYWLDQNRGFLQRMYLNGSKHERLRAVGKGSI
GFAIDWKHNVIFWANQQKGTIELTSRNEKRSRVLLRGLFNPKFVAIDPLEGLLFWSSNKS
WTIIQKATLDGSNVTSIIELSGALKGLTLDTDDKKIFWILSKIDREDSVIGSCSYNGDSV
MIVKNLRLSTKYHVLGVSLLYNHIYYSERKSGSIKVINKFTGKDIVSVNLKPSIMEIRNI
KVVYPVRSYSIPNSSSNQGAKSCSISNKHCTKTCEIDAENQKCHCMNGFVLSSNGRYCED
INECALWNHGCTLGCENIPGSYFCTCPEGYVLLPDNKTCHDKTPCLTEHIECSHGCVQTT
KGPLCTCPEGSVLSEDGKSCTGCTSPDNGGCSHICIMSGPGTWECDCFPGYNLQLDRKQC
LASGTGPRPYLMFANVHDIRRINFDGTNYESVLDSQIGRVFALDYDPVEDRMYFAHTALK
CIESANMDGSDRKKMISGDLSTLEGLTVDAINRKLYWTDRGKSCIERSDLNGKYRKILIQ
ENNIQPRGICVHPLAKKLFWTHVGANPRIESSDLEGSEREVIISKDLIWPSGITVDHLTD
VIYWCDAKKSVIESANLDGSNRQSFSQNDVGHPFAISVFEDHLWVSDWVQPSLIRIEKRN
TQNWVRLRGNMQRPSSVVIVHPLAKPVIADDIPLPRKEKDSNNQTAHSESFFPGPLSTSN
AEMGTREAPSSRNGLLAEIMVSDDSGCIDIHCDINAHCVSSEDGPKCQCLEGFTGNGRLC
HDIDECSLHIAACNPHQTECIDTEGGYICKCKYGYIGNGLQCTDIDECSRGTHTCGENAV
CTNTEGNYTCTCTNGFPGSAADCTGKTIIRECPLAYDGYCLNGGVCIHFPELKDYGCRCV
AGYVGERCQFDDLKSWEKHVTQMKIHNVTIAVSLLLLLLILGLGSFATYYYRHQMTHRKN
HFKQETAPGTTEKPICSTSGLSRSSEPGCLPQI
Download sequence
Identical sequences F7BYJ3
ENSXETP00000052037 ENSXETP00000052035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]