SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000053359 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000053359
Domain Number 1 Region: 599-814
Classification Level Classification E-value
Superfamily GFP-like 3.14e-59
Family Domain G2 of nidogen-1 0.0004
Further Details:      
 
Domain Number 2 Region: 157-254
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 84-173
Classification Level Classification E-value
Superfamily Immunoglobulin 1.6e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 426-483
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.75e-16
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 5 Region: 314-366
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000301
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 6 Region: 2-77
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000104
Family I set domains 0.013
Further Details:      
 
Domain Number 7 Region: 254-310
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 8 Region: 540-597
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000301
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 9 Region: 483-540
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000432
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 10 Region: 368-426
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000131
Family TSP-1 type 1 repeat 0.00028
Further Details:      
 
Domain Number 11 Region: 1042-1094
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000307
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 12 Region: 927-1031
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000122
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 13 Region: 820-962
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000518
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000053359
Domain Number - Region: 1082-1125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000878
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000053359   Gene: ENSXETG00000017411   Transcript: ENSXETT00000053359
Sequence length 1246
Comment pep:known scaffold:JGI_4.2:GL172705.1:1754624:1775760:1 gene:ENSXETG00000017411 transcript:ENSXETT00000053359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERLSLLCKATGNPLPHTTWIFKDKILPVLQDRRSKQQNELVIDKVSRENSGAYMCVAENI
VASINTTIHVFVKEPPVLNGVHNKHRTVPLGGNIILNCVVKGNPFPKIQWHKKAKVISYN
KHIKEFSNGSLAIYDAGLEDVGDYTCIAANDAGVLEHTVTLTLQRPPTIKVPPLDTTVDA
GATVALNCQSEGEPVPTITWYRHNNPISSEDRITILPNNSLQIVSAQKEDTSVYECKATN
IMGTDVVKVTFTVQVHGGFSEWLPWQSCSVTCGQGIQRRIRLCDNPLPANGGNYCQGAET
ETRSCQNKLCPDIVDGNWSEWSTWEECSRSCGSGKRTRVRTCSDPPAQEGGKPCIGKAVD
VAVCNVKPCPVHGMWGPWQSWGACTKTCWKGTKMRVRLCNNPTPSPDGLPCEGQDTQMQI
CGDRQCPVDGKWSAWGSWTSCSLSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMCNA
DLCPVHGNWGPWSHWGSCSRTCNGGQMRRYRACDNPAPSHSGRACTGTDTETNKCNTDLC
PAHGNWGQWEAWSKCSVSCGGGEQIRTRVCHHPARSYTGRPCPGDSTQLLRCNVQACPGG
PQRVKGNLFGRINDLDFGMAPLNATITDDPNSGSRILQAKFTNIPKSLGPSMRNLVSLLN
PIYWTTAKEIGEAVNGFSLTGGIFKRESQVEFATGEILKITHTARGVESDGSLLLDTVVK
GNVLQLQTSVDIHLKDYTEDYIQTGPGQVHAYSTRMFSVDGVYVPYTWNHTINYDVGQGT
MPFLTETLQVNSIETDYNPQEESLSFQVHASISRGDLSIQCPSGFSLDSTGLYCTDICEP
TGVHSSYMFAIQVPLKQCSPAGKTTFIELIRTENIDECTLEDSICRKNQECKNTVGSYIC
GVKCGVGFRAAANDLVCQDINECLESNPCHQRCLNSVGSYHCGCDTGYQLKGRRCIEDLN
ECRHGVCRQDQLCKNTRGSYKCIDVCPIGLTRAENGTCVDINECQDGTHLCKNNQICENT
LGGYLCPCVRGNGAQSLGLQLRDINECEKGDVCQHECRNVLGSYKCLCPPGYQLMANGKT
CQDIDECLEQNIQCGMNRMCFNMRGSHQCIDTPCPPNYIRDTISGYCLKNCAPNDLECAL
SPYALQYKLVSLPFGIAANQDLIRLVAYTEDGILHPRTTFLITDDYASLPFSIREENMKG
VVFTNRPLQKPETYRMKVKALSYSIDRTIEYQTAFIVYIAVSPYPY
Download sequence
Identical sequences F7ACV2
ENSXETP00000053359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]