SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000055326 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000055326
Domain Number 1 Region: 6-184
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.36e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000104
Further Details:      
 
Domain Number 2 Region: 179-303
Classification Level Classification E-value
Superfamily E set domains 6.3e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000055326   Gene: ENSXETG00000026173   Transcript: ENSXETT00000055326
Sequence length 539
Comment pep:known scaffold:JGI_4.2:GL173110.1:14137:41095:-1 gene:ENSXETG00000026173 transcript:ENSXETT00000055326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSHPHVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINHYQGSARIR
ISLVTKDSPHKPHPHELVGKDCKDGYYEAELSPDRSIHSFQNLGIQCVKKREVEDAIAHR
IRTNNNPFNVPPEELKSDYDLNTVCLCFQVFIPDRAAGQVVPLPFVVSQPIYDNRAPNTA
ELKICRVNRNSGSCMGGDEIFLLCDKVQKEDIEVLFVLGNWEARGIFSQADVHRQVAIVF
RTPAFQDTKIRQSVKVQMQLRRPSDKEVSEPMEFQYLPDEVDPHHIDEKRKRTLDSFKHY
VKNPFAGGETRTPRRIAVPNRIVPTKALNHFPFFWNMHSICSVHFIPEPITASIRPSPSV
PNPMVPSLSFSMPVLKVDSVTSASTRLSTVNISDFSNLGFSSQPPPQSDPDRIESFLNYP
SFSGDANLDLVEMLPNDTESRCTSLSSIDNSDFSQLLSESQTSGTLSAGLQEPGTSQGTL
MSYPDSIARLMTNRPIEDDGEERIDSVLMNGVFDMQQGVESITSLLDLDLSSFMNIKCS
Download sequence
Identical sequences F6Y645
ENSXETP00000055326 ENSXETP00000055326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]