SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000057371 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000057371
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 7.67e-86
Family Integrin A (or I) domain 0.0000000768
Further Details:      
 
Domain Number 2 Region: 372-458
Classification Level Classification E-value
Superfamily Integrin domains 2.72e-23
Family Integrin domains 0.00025
Further Details:      
 
Domain Number 3 Region: 617-699
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.41e-16
Family Integrin beta tail domain 0.00082
Further Details:      
 
Domain Number 4 Region: 20-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000225
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 574-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Integrin beta EGF-like domains 0.0017
Further Details:      
 
Domain Number 6 Region: 533-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Integrin beta EGF-like domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000057371   Gene: ENSXETG00000027510   Transcript: ENSXETT00000057371
Sequence length 778
Comment pep:known scaffold:JGI_4.2:GL172687.1:1579429:1644016:1 gene:ENSXETG00000027510 transcript:ENSXETT00000057371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELICLFAFILHGKNHVQGSCALGSTMTCGECLKLGPHCAWCSHKNFTDSLDIAVRCD
TYEVLQSKGCPAESIEFPDSKLEVLRNKPLTEGAQENSSDATQISPQKLLLKLRPGRELT
FQIDVRQTENYPVDLYYLMDLSASMEDDLKTIKELGSSLSKEMSKLTNNFQLGFGSFVEK
PVSPFIKTVPKDIENPCHSIPYYCLPTFGYKHVLSLTPNAQNFNEIVKKQWISGNIDTPE
GGFDAIMQAAVCKEQIGWRNGSLHLLVFVSDGDSHYGMDSKLAGIVIPNDGLCHLDSSNE
YYMSTVQEYPSVGQLIEKLVENNILLIFAVTKAYVPLYQGYASLIPGATVGLLAKDSGNV
LQLIINAYKELRSEIELEVLGDTEGLSLSFTALCNNNTAIPHSKKCQHLKVGDRVSFSVS
ITSASCEKHTRHIVIKPVGLEESLEVEIQSECSCQCHREERSSECSKGNGALECGVCVCY
PPYLGDHCQCNEGSLNSSSCKELDSCGGRGECYCGQCICYPSVYGRIYGSHCECDDFSCL
RHRGVICAGHGDCECGECICHSGWSGSYCNCTMDTQTCISENGALCSGRGECVCGKCVCN
NPEVSGDVCERCPTCGDPCSSKRACVECHLLPAEEQQEECEETCKLVDATVSNAEDFSED
KSISCSLQGENECAITFGMATDEHGKKVIYNIQQKDCPHAPNILMIVIGVSIAIALIGIV
ILCIWKLFVSFQDRREVAKFEAERMKAKWDSGTNPLYKGSTSTFKNVTYRRQDKQING
Download sequence
Identical sequences F6VN77
ENSXETP00000057371 ENSXETP00000057371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]