SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000058957 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000058957
Domain Number 1 Region: 219-355,392-448
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.6e-38
Family Protein kinases, catalytic subunit 0.000000489
Further Details:      
 
Domain Number 2 Region: 115-253
Classification Level Classification E-value
Superfamily SH2 domain 8.82e-37
Family SH2 domain 0.0000172
Further Details:      
 
Domain Number 3 Region: 55-139
Classification Level Classification E-value
Superfamily SH3-domain 2.4e-19
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000058957   Gene: ENSXETG00000024009   Transcript: ENSXETT00000064073
Sequence length 454
Comment pep:known_by_projection scaffold:JGI_4.2:GL174165.1:50377:66816:1 gene:ENSXETG00000024009 transcript:ENSXETT00000064073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKDSHGSMRSLRRKVTLGGYRGSVSVSPTYLVFKTKVERSSKHPKEEGQEEVVLL
ALYDYDGVHPGDLTFRKGDHLLLKKESGEWWEAYLISTREEGFVPSNYVARVDSLESKEW
YFKDMGRKEAERQLLSPLNTCGAFMIRDSETTKGSFSLSVRDSGDTVRHYKIRTHEDGGF
FISTRITFPSLPELVSHYQGKMSGLCQCLTVPCQTLRPEKPWEKDAWEIPRESLSLQKKL
GTGQFGDVWLATYNGHTEVAVKTMKAGSMSPAAFLEEANLMKSLQHERLVRLHAVVTQGE
PIYIVTEYMHKGSLLDFLKSPEGSRQPVTQLIDFCAQMAGIGAIRHRTPSRSSHRSGLSL
LTNTLLCPPSKPPNLFRWDPPTPQVTFLITSFCSQGSKFPIKWTSPEAANYGSFTIKSDI
WSFGVLLSEIMTYGRSPYPGESSVAILISRLERG
Download sequence
Identical sequences F7C3C1
ENSXETP00000058957 ENSXETP00000058957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]